KEGG   Cryptosporidium parvum: cgd6_1380Help
Entry
cgd6_1380         CDS       T00168                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     cgd6_1380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 440 aa AA seqDB search
RYLLYKLSMGAKKKIAYFYDEEVGNFHYGLGHPMKPHRVRMTHDLVSQYGLLEKVDVMVP
TPGTVESLTRFHSNDYVDFLRSVNTDNMHDYSDHLARFNVGEDCPVFDGLWEFCQLSAGG
SLGGAQSVNELGYQYAINWAGGLHHGKKHEASGFCYVNDCVLGALEFLKYQHRVCYVDID
IHHGDGVEEAFYTSPRCMCVSFHKYGDYFPGTGALNDVGVEEGLGYSVNVPLKDGVDDAT
FIDLFTKVMTLVMENYRPGAIVLQCGADSLSGDRLGCFNLSLKGHGHAVSFLKKFNVPLL
ILGGGGYTLRNVPKCWTYETSLIVDTYIDEQLPNSSNFYGYYGPDFSLAVRTSNMENLNS
RQDCEEIYRKISENFRDYVFPIGSQISAYDIPEKLPLLYNPNKTPDDYKDGNNIKHEQHQ
DFDDEMKEWPTVDYNNRAIG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
agatatctattatataaattatcaatgggagccaagaagaaaatagcatatttctatgac
gaggaagttggaaatttccactatggcttgggccatccaatgaagccgcatagagttaga
atgacccatgaccttgtttctcaatacgggttattagaaaaagttgatgttatggtaccg
acccctgggacagtcgagtctttgacaaggtttcattcgaatgactatgtagacttttta
cgtagcgttaatactgataatatgcatgactattctgatcacttagctagattcaacgta
ggtgaagactgccctgtatttgatggcctgtgggaattttgtcagttgtctgccggggga
tcacttggaggggctcaatctgttaatgagttgggatatcagtatgcaataaactgggca
ggagggctccaccatggaaaaaaacacgaagctagtggtttttgttatgttaatgattgc
gtattgggcgctttagagtttttgaaatatcaacatagagtttgttatgttgatattgat
atccatcatggagatggcgttgaagaagctttttatacttctcccagatgtatgtgcgtt
tcatttcacaaatatggtgactactttccaggaactggagcactaaatgatgtaggagtg
gaggaaggtcttggatattccgtaaatgttcctttgaaagacggggttgatgacgcaact
tttattgacttgtttactaaagttatgacgctggtaatggaaaattatagaccgggggca
attgttttacagtgcggagctgactcactatcaggagatagactaggttgttttaaccta
tcacttaagggacatgggcatgccgtttcttttttaaagaaattcaacgttccattgctt
attttaggaggtggtggttacacactcagaaatgttccaaaatgctggacgtatgaaaca
agtttaatagttgacacatatattgatgaacagcttcctaattcgtcaaatttctatggg
tactatggacctgatttttccttagcagttagaacttcaaatatggaaaatctaaactca
agacaagattgtgaagaaatttataggaaaataagtgaaaacttcagggattatgtgttt
ccaatcggatctcaaatatcagcatacgacatacccgagaagctccctctcttatataat
ccaaacaagactccagatgactataaagatggcaacaacattaaacacgaacagcatcag
gatttcgatgatgagatgaaagaatggcctacggttgattacaacaacagggctattgga
tag

DBGET integrated database retrieval system