KEGG   Cryptosporidium parvum: cgd6_2590Help
Entry
cgd6_2590         CDS       T00168                                 

Definition
histone acetyltransferase (MYST family); chromo domain + C2H2 domain
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 552 aa AA seqDB search
MVNMALRSRSSNIQKQQANNTPSNTSNNNEAVSSELISSENQRKKTNARIYSSIEEHSDK
TLDECKEDEAVPTIEKGPTADFPSVNQWVLALFEEEGKQMLARVVGWKLYGTQVTHLSHL
VNKKTGGNKQNSLIKVSSSSNESQIKEDYEFYVHFRGLNRRLDRWVKGKDIKLSFDVEEL
NDPVLIERFQKQGIKFISSLVVSNSANKSGNKSKKRNVGVLDISDGEDPDEHEGMDHSAI
LDHEETTRLRTIGRVRIGKFILDTWYFSPLPDEYQNVDTLHFCEYCLDFFCFEDELIRHL
SRCQLRHPPGNEIYRKDNISVFEIDGALTRGYAENLCYLAKLFLDHKTLQYDVEPFLFYI
VTEVDEEGCHIVGYFSKEKVSLLHYNLACILTLPCYQRKGYGKLLVDLSYKLSLKEGKWG
HPERPLSDLGRAIYNNWWAHRISEYLLEYFKQNKICERGGSKQPLQVSNYSKFIDNVVRS
TGIRREDVIRILEENGIMRNIKDQHYIFCNQEFLKGIVKRSGRPGITLIDKNFNWVPFSR
APPSEVESLPQE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggttaatatggctttgcgttcaaggtcatccaacattcaaaaacaacaggcaaataat
acaccaagtaatacttcaaataataatgaagcagtctcaagcgaattaatttcatctgaa
aatcaaaggaaaaagacgaatgcaagaatctacagctcaattgaggaacattcagataag
actttggatgaatgtaaggaagatgaagcagttcctacaatagaaaaaggcccaacagcc
gacttcccaagtgtgaaccaatgggtactggcactatttgaggaagaaggtaaacagatg
ctcgctcgcgtagtaggttggaagctttatggaactcaggtcactcatttatcgcattta
gtgaacaaaaagacgggagggaataaacagaattctttaatcaaagtgagttcatcgtct
aatgagtcgcaaatcaaggaggattatgagttttatgtgcattttagaggtctaaataga
cgtctggatagatgggttaaaggtaaagatataaaactctcttttgatgttgaagaatta
aatgatcctgttttaattgagaggtttcagaaacagggaataaaatttatatcttcatta
gtagtttcaaattcagctaataaatctgggaataagtctaagaaaagaaatgtaggggtt
ttggacatttctgatggagaagatcctgatgagcatgaagggatggaccactctgcaatt
cttgaccatgaggaaacaactagacttaggacaattggcagagttcgtataggaaaattc
attttagacacttggtacttttctccactcccagatgagtatcaaaatgttgacacttta
catttttgtgagtactgtttggactttttttgctttgaagatgaacttattaggcatctt
tccaggtgccaactaaggcatcccccaggtaatgaaatatatagaaaggataatatttca
gtcttcgaaattgatggtgcattaactagaggatacgcggaaaatttatgttacttggcc
aaactattcttagatcacaaaactctacagtacgatgtagaaccatttttattctatatt
gtcactgaagttgatgaagagggatgtcatattgtcggctacttttccaaagaaaaggtt
tcattactccattataatcttgcatgtatcctaactttaccttgctatcagaggaagggt
tatggaaagcttcttgttgacttgtcatataaactttcgcttaaagaaggtaaatgggga
catcctgaaagacctctttctgacttgggtagggcaatctataataattggtgggcccat
aggatatctgaatatcttctcgaatattttaaacaaaacaagatatgtgaaagaggtggt
tcgaaacaacctctccaagtaagtaactatagtaagtttattgacaacgttgtaagaagc
actggaatcaggagggaggatgtaatcagaattttggaagaaaacggaattatgagaaat
atcaaggatcaacattatattttctgtaaccaggaatttctcaagggtattgttaaacgt
tctggaagaccaggaattactttaattgataaaaattttaactgggttccctttagtaga
gctcctccatcggaagttgaatcacttccacaagagtag

DBGET integrated database retrieval system