KEGG   Cryptosporidium parvum: cgd6_3280Help
Entry
cgd6_3280         CDS       T00168                                 

Definition
glycogen branching enzyme (1,4-alpha-glucan branching enzyme)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpv  Cryptosporidium parvum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 1030 aa AA seqDB search
MSTRGVLQKYNMKSLKEQKIDTTLSGKQKTECKVKSSSKFTGEVLITSKNISSPTQSLEK
SDSLPVSSSDNSRIESSVPTAANSPTSYSSSMASIPDERGDIYEALDRVPDDGKILDHDL
HLLNKALHPEPFGVLGYQKFGDDGQYEYYVVRAWVRNARRIQIKAIDYSFSSIGTNNTPV
EMEQRYIDGNPSWMFEKAFKTLKEKIPTCRTHFCGYDENLENSNIENKRIGNQSNKDDYS
TDKFSDVGSEANNKVNKNTIVSKKKEITADCNSIVEKTYSNVIVNTLNKSKTNLVPNKES
HKGNEMPKLELNQSNLMSSNIPRNKNIRSEACSSDEACNCYVHDNINSQECVRKLYYELL
VEYNGDDSGKVYAIRDTYSFGLLLSNGDMELFQSGSCWHVDNILGSHIIEYNGVKGVRFS
VWAPHAKYVRVVGDWNSWDGRVNPMRFRHGVGIWELFIPHLGPGEKYGYEIHSQSNDVFV
KIDPYSQEYEVPPRYASIISACDDSYKDETDRFRWEDQEWIKRREQLGSKGEMRRQPMSI
YEVHLPSWMRRENGDYLGYREIAERLVEHVKNLNFTHVEFLPLAQHPFEGSWGYQVTGQY
APYSRLGTPDDFKYLVNELHKAKIGVFIDFVPAHFCKDAWGLVYYDGTPTYEYGDPREGE
HKQWGTAVFNFRRNEVRSFLLGAAYHWLRRYHIDGLRIDAVSSMLYRNYLRPNGEWIPNE
FGGDANLEAVSLLQELNWVIHKEFPGVFTMAEESTAWQGVTHKDGGLGFDAKWDLGWMND
TLSYLYTPPDNKSSKHNKLTFRGLYMSHEHWVLPLSHDEVVNGKGSLLDKCGFTGAPYMD
RIRTLKTLFGYQVGMPGRPLLFQGAEIAQGREWKENRSVDWHEGEEDVRKKVCIFLSDLL
AVYKNNVSLHAGDDESWNFQWVDCENSQDCIIAFLRKYKEWYNDVVVVCNFSSRRYNHYP
IGVPHGKEWLVMLNSDDWKYGGAMFGPGNNSTVHASHGGRVGWDYCLWIDIPEFSCMYLK
PLFNPNENDS
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaagaggagttttgcaaaagtataacatgaagtcattgaaagaacaaaagatt
gacacaacattatcggggaaacaaaagactgaatgtaaagtaaaaagcagcagcaaattt
acaggcgaagtattgataacaagtaagaatatatctagcccaacacagagtctggaaaag
agtgattcactacctgtttcatcaagtgataattctaggattgaaagtagtgttccaact
gcagcaaatagtccaacttcatattcaagttcaatggcttcaattccagatgagcgaggc
gatatttacgaagccttggatagagttccagatgatggaaaaattctggaccatgattta
catcttttaaataaggctttacatcctgaaccatttggtgttcttgggtatcaaaagttt
ggtgatgatggccaatacgaatattatgtcgttagagcatgggtcaggaatgctagaaga
attcaaataaaagcaattgactattcattttcttctattggtactaacaatacgcctgtt
gaaatggaacaaagatatattgatggtaatccaagttggatgtttgagaaagcttttaaa
acacttaaggaaaagatacctacttgtagaacccacttttgtggatatgacgagaatttg
gagaattctaatattgaaaataagagaattggaaaccaaagcaataaggatgattattca
accgataagttttcagatgttgggtctgaagctaataataaagtaaacaaaaatacgatt
gtttctaagaaaaaagaaattactgccgattgtaactcgattgtggaaaaaacatattct
aatgttattgtaaatactctgaataaatcgaaaaccaatttggttccgaacaaggaatcg
cataaaggaaatgaaatgcctaagcttgaattgaaccaatcaaatttgatgtcttcaaat
attccgagaaataaaaatattagaagtgaagcatgcagttcagatgaagcttgtaattgt
tatgtgcatgacaacattaactctcaagagtgtgtgagaaaattatattacgaattgctt
gttgaatacaatggagatgattctggtaaagtctatgctattagagatacctattcgttt
ggattactactatcaaatggtgatatggagcttttccaatctggtagttgttggcatgtc
gacaatattctaggttcccatattattgaatacaatggagtaaaaggggtaaggttctca
gtttgggccccccatgccaaatatgttcgtgttgttggagactggaattcttgggatgga
agagtaaatcccatgcgatttcgtcatggcgttggaatctgggagttgtttattccgcat
ctaggcccaggtgagaagtatggatatgaaatacactctcagtcaaacgatgtgtttgtt
aaaattgatccatattcacaagaatatgaggttcctccacgatatgcttccattattagt
gcttgtgatgattcatacaaagatgagactgaccgttttcgttgggaggatcaagaatgg
ataaagagaagagagcaattgggttccaaaggtgagatgagaaggcaacctatgtcaatt
tacgaggttcatcttccaagttggatgaggagagaaaatggagactacttgggatataga
gagattgccgagagacttgttgaacacgttaaaaaccttaactttactcacgttgagttc
ctccctcttgctcaacatccatttgaaggaagctggggatatcaagtaactggacaatat
gctccatatagtcgtttaggtactcctgatgattttaaatacttggttaacgagcttcac
aaggccaagattggagtctttattgactttgttcctgctcatttttgcaaggacgcttgg
ggattggtatattatgatggaactccgacttacgaatatggtgatccaagagaaggtgaa
cacaagcagtggggaactgctgtattcaactttagaagaaatgaagttcgttcattcttg
cttggagctgcttaccattggttgcgtcgttaccatattgatgggctaagaattgatgct
gttagctcaatgttatacagaaattacttaagaccgaatggtgagtggatccccaatgag
tttggaggagatgcaaatcttgaagctgttagccttctacaagagcttaactgggttatt
cataaggaattccctggtgttttcactatggctgaggaaagtactgcttggcagggagtt
acacacaaggatggaggacttgggtttgatgctaaatgggacttgggatggatgaatgat
actctaagttatttgtacaccccccctgataataaaagcagtaagcataataagcttaca
tttagagggctttacatgtctcatgaacattgggttttgccattaagccacgatgaagtt
gttaatggaaagggaagtttacttgataagtgtggattcactggagcgccttatatggat
agaattaggacattaaaaacgctatttggatatcaggttggaatgcctggccgtcctttg
cttttccaaggggctgaaattgctcaaggtagagagtggaaggagaatagatctgttgat
tggcatgaaggagaggaggacgtgagaaaaaaagtctgtattttcctaagcgatttatta
gctgtttacaagaataacgtcagtctccatgctggagatgatgaatcttggaacttccaa
tgggtagattgtgaaaactctcaagattgtattattgctttccttagaaagtacaaagaa
tggtataacgacgtagtggtcgtttgtaactttagctcaaggcgatacaatcattatcca
attggagttcctcatggaaaggagtggcttgtaatgcttaattcggatgattggaagtat
ggaggagcaatgtttggtcctggaaacaactccactgttcatgcttctcacggagggaga
gttggctgggattattgtctctggattgacatacccgagttctcttgtatgtatttaaag
cctttatttaatcctaatgaaaatgattcataa

DBGET integrated database retrieval system