KEGG   Cryptosporidium parvum: cgd6_4550Help
Entry
cgd6_4550         CDS       T00168                                 

Definition
UBP_znfinger+UBA; UBP5 like deubiquitinating enzyme with a UB hydrolase domain and two UBA domains at the C-terminus
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
6
AA seq 921 aa AA seqDB search
MNELFEEYLKLIGSKIERKDPVYKAQCQLSFKDSFSEGGLYVNLKNFEAYSRDFLEWDYS
QSGCRLYLSIKGTRKYHPENIDNPTNLSIGKEGGYFPEKPFFEDLFQYGLVSFPDMEVME
LTDSRVHKELSERLNYIIQYDQNMELSKDTDSLVAWAEERKVSRHAENLFQVSSPKQISP
KGWTCETCGASTNLWLNLSDGFIGCGRRLYGVGGGCFDGKDEGAALLHYQQHTERPLAVK
LGTITQFGNADVFSYDPQEDDLVLDPHLVKHLSVFGINVGQLEKTEKSLTEMQIEQNNKL
DLTSGTESEECGSFLPMNKLFKKGDLLTALVGLENSGNSCYVNVVLQLLASIPEVGELFS
IHFQDLLEIYSKYFIQKTRPRESIVIQFSKVIKALLTNDVINDRNYKISSRSKDIQKAIS
ELKEKGINENIIESLTESEVNPCLVHILPSILKRTISKGNPEFSSSHQQDTLEYFTFLQE
KLSDDLKKYYNHSSQEIQKLIQQFINLFSFFIGERLECKQTGSVKLTSQLNNVLSLPIPK
DLITYSSDTRQTKKPKHAFGEDGEDLATPKSNHLKEQDMNDDHECFSDISLLLSNWRQEE
IVESFLSPCTNQLGKAGKSNFIKSMPKYLIIHMQRFYLSEDWRPKKINLSVKVPNFLDLE
SLRDSEELKPGEKPFPEGVDEVNKSLKEEVQVPESLVNSVLDLGFTKSHAELAVKNTFST
DIDICINWILTNIDSINSMDLTSSDSSSSSSSSSASNTSKTNNSASHQDLEAIENIISIC
CCSRDIAEKAFKISNQNLERAIQMIFDDPSIIESFEDTQLQQQVSVGPDLSSKLIELDDG
PGKYELIGVICHLGKSVHSGHYICYNKRKIDSSINPSNQPTESSCSSSIWVRFNDTKVYL
SKEDDFPHKEKGYIYLYRRTN
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactttttgaggagtatttaaagcttattggaagtaagatagaaagaaaggat
ccggtttacaaagcacaatgtcaattgtcatttaaggattctttctctgaaggggggctc
tacgttaatttgaagaattttgaagcatatagtagggattttcttgaatgggattatagt
cagagtggctgtaggctttatttgagtattaaaggcactagaaaatatcacccagaaaat
attgataatcccacaaatttgtcaataggcaaagagggaggatactttccagagaagcca
ttttttgaggacttattccaatacggtttggtatcttttccagatatggaagtaatggaa
ttgacggatagccgggttcataaagaactttctgaaaggcttaattatataatccaatac
gaccagaacatggaattaagcaaagatacggactctttggttgcctgggctgaagaaaga
aaagtttcaaggcatgctgagaatctttttcaggtatcttctcctaagcaaatttctcct
aaaggttggacatgtgagacttgtggagcaagtacaaatttatggttaaatttatcagat
ggatttattggatgtggaagaaggttatacggagttggaggtggttgctttgatggaaag
gatgaaggagcggctttacttcactatcaacaacatacagaaagacctttggcagttaag
ttgggaacaataactcagtttggaaatgcggatgtgttttcctacgatccacaagaggat
gatttggttctggatcctcatctagtaaaacatctttcagtatttggaataaatgttggg
caacttgaaaagactgaaaaaagtttaacagaaatgcaaattgagcagaataacaagtta
gatttgacaagtggaacagaatctgaagaatgtggtagttttttaccaatgaataaacta
tttaaaaaaggtgatttactaacagctcttgtaggacttgagaactctggtaactcttgt
tatgttaacgtagttttgcaacttcttgcatctattccagaagtaggagagcttttttca
atccattttcaagatttactggaaatttactccaaatattttattcaaaaaacaaggcca
agagaaagtattgtaattcagttttctaaagtaattaaggctttacttacaaatgatgta
attaatgatcgtaattataagatttcatctcgttctaaagatattcaaaaagctatttct
gagcttaaagagaaaggtattaatgaaaatatcattgaatctttaacagaaagtgaagtc
aatccttgtttagtgcatattcttccttcaatactaaaaagaactatttctaaaggtaat
cctgagttttcttcatcccaccagcaagatactcttgaatattttaccttccttcaagaa
aagctatctgatgatcttaaaaagtattacaatcattcttcacaggaaattcagaagtta
attcaacaatttattaatcttttcagtttcttcattggagaaagacttgaatgtaaacaa
acaggatctgtaaagcttacttctcagttaaataatgtattatcactaccaatacctaag
gatttaattacttatagttcagacactaggcaaaccaaaaagccaaaacatgcctttggt
gaggatggtgaagatttagctactcctaaatctaatcatcttaaagaacaagatatgaat
gatgatcacgaatgttttagcgatatttccctcttactttccaattggaggcaagaagag
atagtagaaagttttctctctccttgtacaaatcaattgggtaaggctggaaaatcaaat
tttattaaatctatgccaaaatacctcattatacatatgcaaagattctatttatcagaa
gattggagacctaagaaaattaacttaagtgttaaagtcccaaatttcttagatttagaa
tctttaagagattctgaagagctaaaacctggtgaaaagcctttccctgaaggagtagat
gaagttaataaatctttaaaagaagaagtccaggttccagaatctctggtgaattctgtt
ttggatttgggattcaccaaatcacatgctgaactggctgttaagaatactttctcaaca
gatatagatatatgtattaattggatactgacaaatattgactcaatcaattctatggat
ttgacttcatccgattcatcatcatcatcttcttcctcatctgcttcaaatacttccaaa
accaataattcagcatctcaccaggatctagaagctattgagaatattatttcaatatgt
tgttgttcaagagatattgcagagaaagcattcaaaatttcaaatcaaaacttagagaga
gctatacaaatgatttttgatgatccttcaattattgaaagttttgaagatacacaatta
caacaacaagtatcagttgggccagatctttcttcaaaactcatagaacttgatgatgga
ccaggaaaatatgaattaattggagttatttgccatctaggaaaaagtgttcatagcgga
cactacatatgttataataaaagaaagattgattcctctattaatccatctaaccagcca
actgaatcgtcctgttcttcctctatatgggtaagatttaatgatacaaaagtttattta
agtaaagaggatgattttccccataaggaaaaagggtatatctatctatatcgcagaact
aactaa

DBGET integrated database retrieval system