KEGG   Cryptosporidium parvum: cgd7_1430Help
Entry
cgd7_1430         CDS       T00168                                 

Definition
possible phosphodiesterase/alkaline phosphatase D, of possible plant or bacterial origin
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cpv  Cryptosporidium parvum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpv00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 463 aa AA seqDB search
MPSIFWIYLTFHLFIGVFAEDSSSEKLLKSLVFISCVDGQKQDKSGNYVSQEYWKAIQSD
KPDALFWMGDSVYTKCGSPVCVSKGYLVQSNNSFYRDLLKTGLFVDGTWDDHDYGVNDGG
KYVAFKDESQQLFLDFISLPKDSPRRNRKGVYSSHTFGPPGKQIKVIILDTRYHRDNYYV
HERYGILSFAHLDTPFTSIFAASLRFFASIFGYGHSYQGDMLGKEQWDWLEKELSNSKAL
ANIIISSIQVTTQYPIVEGWGHFPKSRERLFSLIKKTKPKGLFFLSGDVHWGQIFESDDS
QKSLVEITSSGMTHSVSDRILDSFVISTTLPIFTGWSLNDKSPNYFIRENYGKLDFEYLC
TDSKECSGIIVKATIRDLNGDIKLKKIFKFDNESNENHIEAISKIPQMIVEKSARQIFGR
LCIIIVSIIWGIQIVIVFLYFILRIITSFTRLFSKNNSKAKSE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcatattttggatatatttgacttttcatctattcattggagtatttgcagaa
gacagcagctctgagaaacttttgaaatctttagtgtttatcagctgtgtggatggccag
aaacaagataaatcaggtaattatgtaagccaagagtattggaaagcaattcaatctgac
aaaccagatgctttattttggatgggagattctgtttatactaaatgtgggtctccagta
tgtgtaagtaagggataccttgttcaaagtaataattcattttatagagaccttttgaag
actggtttatttgttgatggtacttgggacgatcacgattatggtgttaacgatggtgga
aaatacgttgcttttaaagacgagagtcagcaactatttttagactttatttctcttcct
aaggattctccaagaagaaataggaagggtgtttactcatcacatacttttggtcctcct
ggaaagcaaattaaagtaattattttggacacaaggtatcatagagataattattacgtt
cacgaaagatatggtattttatctttcgctcatttggatactccatttaccagtattttt
gcagcatctcttcgtttctttgcatctatttttggctatgggcattcatatcaaggagat
atgttgggaaaggagcaatgggattggttagagaaagaacttagtaactctaaggctctt
gctaatattattatctcatctatacaagttaccacacaatacccaattgttgaaggttgg
ggacattttccaaagtctagagaaagattgttttcgcttattaagaagacaaaaccaaaa
ggactattcttcttatcaggggatgtccactggggtcaaatctttgagtctgacgattct
cagaagtcattagttgaaattacttcaagtggaatgactcatagcgtaagtgaccgaatt
ctggatagttttgttatttctacaacattaccaatctttacgggctggtctttgaatgac
aagtctccaaattactttattagagaaaactatggaaaacttgactttgagtacttatgt
acagattctaaagaatgttcaggaatcatagttaaggccactattagggatttgaatgga
gatattaagctaaagaagattttcaaatttgataatgaaagtaatgaaaatcatatcgag
gctatttctaaaattcctcaaatgattgttgaaaaatcagcaagacagatatttggtaga
ttatgcataataatcgtctcaatcatttggggtatccagattgtcatcgtattcttatac
ttcatattacgtataatcacgtcattcacaagactcttttcaaagaacaatagcaaagca
aagagtgaataa

DBGET integrated database retrieval system