KEGG   Cryptosporidium parvum: cgd7_1700Help
Entry
cgd7_1700         CDS       T00168                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 131 aa AA seqDB search
MSGKSGKSIKGPAQKQQAAKKTAGKSPADGGKRKRRKRTESFALYIYKVLKQVHPETGIS
KKSMSIMNSFINDVFDRLSAEAVKLVQYNKKRTLSSREVQTSVRLMLPGELSKHAVSEGT
KAVTKYTSASA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaagtggtaaatcaattaagggaccagcccagaagcagcaagcagcaaag
aagactgcaggaaagtctccagcagacggtggcaagagaaagagacgtaagagaacagaa
tcctttgctctttacatctacaaggttttgaagcaggttcatccagagactggtattagt
aagaagagcatgagtatcatgaactcttttataaatgatgtttttgatcgtctctcagct
gaagctgtcaagttggttcagtataacaagaagaggactttatcaagcagagaggttcag
acttcagttagattaatgcttccaggtgagctctcaaagcatgcagtctctgaaggaact
aaagctgttactaaatacacttctgcatctgcttaa

DBGET integrated database retrieval system