KEGG   Cryptosporidium parvum: cgd7_1700Help
Entry
cgd7_1700         CDS       T00168                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cpv  Cryptosporidium parvum
Brite
Exosome [BR:cpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cgd7_1700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 131 aa AA seqDB search
MSGKSGKSIKGPAQKQQAAKKTAGKSPADGGKRKRRKRTESFALYIYKVLKQVHPETGIS
KKSMSIMNSFINDVFDRLSAEAVKLVQYNKKRTLSSREVQTSVRLMLPGELSKHAVSEGT
KAVTKYTSASA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaagtggtaaatcaattaagggaccagcccagaagcagcaagcagcaaag
aagactgcaggaaagtctccagcagacggtggcaagagaaagagacgtaagagaacagaa
tcctttgctctttacatctacaaggttttgaagcaggttcatccagagactggtattagt
aagaagagcatgagtatcatgaactcttttataaatgatgtttttgatcgtctctcagct
gaagctgtcaagttggttcagtataacaagaagaggactttatcaagcagagaggttcag
acttcagttagattaatgcttccaggtgagctctcaaagcatgcagtctctgaaggaact
aaagctgttactaaatacacttctgcatctgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system