KEGG   Cryptosporidium parvum: cgd7_2190Help
Entry
cgd7_2190         CDS       T00168                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpv  Cryptosporidium parvum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cgd7_2190
Enzymes [BR:cpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     cgd7_2190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 193 aa AA seqDB search
MKDILVICGPSGVGKGTLISHLMQEFPDKFGFSISHTSRSPRGKESNGVEYYFCSNEEFI
NMISMDGFVEYAEVHKYFYGTSKQAIEDIINQRKICLIDIDIQGVEQIQKSSFGDRAYYI
GILPKSQMDLEERLRKRKTDSEQAIQIRLQNSVEEIERINRNPNIYKLVNDDLKTACDEI
ARLVKSYWEDISY
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattctagtcatttgtggcccgagcggagtggggaagggaactttgatttct
caccttatgcaagagtttcctgacaagtttgggttttcaatttcccatactagtagaagc
cccaggggaaaagaatctaatggggtagaatattatttttgctcaaacgaggagtttata
aacatgatatctatggatggttttgtcgaatatgctgaagtacataaatacttctatggt
acctctaagcaagcaatagaagacatcattaatcaaagaaagatttgtttaattgacatc
gatattcagggagttgagcaaatacaaaagtcatcatttggtgatagggcatattacatc
ggaattcttccaaagtctcaaatggacttggaagagagacttagaaagagaaaaacagac
tcagagcaggcaattcagattaggttgcaaaattctgtagaggaaattgagaggattaat
cgcaatccaaacatttataagttggttaatgacgatttaaaaactgcatgcgatgagatt
gccagattagttaaatcatattgggaagatatttcttattaa

DBGET integrated database retrieval system