KEGG   Cryptosporidium parvum: cgd7_2670Help
Entry
cgd7_2670         CDS       T00168                                 

Definition
serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cpv  Cryptosporidium parvum
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:cpv03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 320 aa AA seqDB search
MTPQPSSTTISGTANGSNNDIDVDSIIAKLLEVRGSRPGKPVQLTEKEIRGICIKSREIF
MSQPTLLELDAPIKICGDIHGQYYDLLRLFEYGGFPPDTNYLFLGDYVDRGKQSLETICL
LFAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIID
EKILCMHGGLSPELHKLDQIRKIERPTDVPDTGLLCDLLWSDPEKDVRGWGENDRGVSFT
FGHDVVEKFLRDHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD
ETLMCSFQILKPVEKKKLKP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacaaccttcatctactacaatatcaggaactgcgaatggttctaataatgat
attgacgtagactcaataatagccaagctattagaggtgcgtggttctcgtccggggaag
ccagttcaacttacagagaaagagatacgcggaatatgtattaaatctcgtgagatattt
atgagccaacctactttacttgaattagatgcacctattaaaatatgtggagacatacat
ggacaatactatgacttacttagactttttgagtacggtggtttcccaccagacactaat
tatttgtttcttggagattatgtagatagaggtaaacagagcttggaaactatatgcctt
ttgtttgcatacaaaataaaatatccggagaattttttcttattgagaggaaatcatgag
tgtgcatctatcaatcgaatttatggattctacgatgaatgtaaaagaaggtataatgta
aagctttggaagacttttacagattgttttaattgcttacccgttgctgccataattgat
gagaagattctttgtatgcatggcggactttctcctgaattacataaattggatcaaata
agaaagattgaaaggcctacagatgttccagacacgggcttgctttgcgatctgttgtgg
tctgatcctgaaaaggatgtaagaggatggggagaaaatgataggggtgtatcattcaca
tttggtcacgatgtggttgagaaatttctgagagatcatgatatggatcttatctgcaga
gcccatcaagtggtagaggatggatatgaattttttgccaaacgacagttggtcaccctt
ttttctgcccctaattactgtggagaatttgataatgcaggtgcaatgatgtctgttgat
gaaacgttaatgtgttctttccagattttaaagcctgtagagaaaaagaaacttaaaccg
taa

DBGET integrated database retrieval system