KEGG   Cryptosporidium parvum: cgd7_3680Help
Entry
cgd7_3680         CDS       T00168                                 

Definition
TPR repeat protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cpv  Cryptosporidium parvum
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    cgd7_3680
Protein phosphatases and associated proteins [BR:cpv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     cgd7_3680
Ubiquitin system [BR:cpv04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     cgd7_3680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 791 aa AA seqDB search
MEDELLSILTYLDRWQLYDNIRFWAEVIDKLLESKEARIQISRFLVKDLNLQEAFNYLRV
ECDKTKLQLSSNEDSINKEVNLYGDYLTIKCCYLMGRIDEAERMILKICSKPLTELADSC
LISPSVSPKSWKGTPVTNEKKKSLSSIFSTICMNPTMLIKYIHTGELKIPGDSAGLYLWG
NILEELDAKVSALYCYAIALDWNPVLWKSFQKLVGLSCQYPHELVKICCCLNNWGEKHLE
YVGTNSDALVISTVYKNEAECWQVKNIQDGNLLISISDKSDSEELYVLNVSDFFYNVGDT
LQKRHMLRYHSFTNWLENPVKDGNSGPKWPYSEFEDVKNANNKFSSSNISEINYNSVAYT
ENIDANIKPLDSRFHPLISMIQLLSKFTHQMEWYLCHSFLKNIESIPNKISEMGYVRELH
VRALFESNQWQECINVCKCINYETNYNLWIKCLDIYSSCLWQLSRSIDLINLSNLTLKII
EKNTPQLWIVVGNCFSLHKEYESSIKCFKRAIQYDNRYVYAYTLIGHELSIIEKYDEAIQ
MYQKALKIDPRCHRAHWGIGYVWFKREEYYQAKSHFNLALKVVPNNSTLIHYLGLCYLTT
HDFLSAYNTFQKGILKDQRNPWLKYHAGIVLLELERYEEALTMLTAAHRLASNEPNIHLY
LGKTFSHLGRKDKALRHLNIAFDLTKDINEKQIILNLMKELENGSNIEGRYCKSNETNRS
GRISNSGAGYSSGSKLLSSFRNHHYFPIRNDPPNPFIHHQIQQEHNIPQTVPSPAVSGGH
SLLLTLMPGNN
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgagttattgtccattttaacctaccttgatagatggcaattgtatgacaac
attagattttgggctgaagtaatcgacaaattattggaaagcaaagaagcaagaattcaa
atatctagatttcttgtgaaggatttgaatttacaggaagcttttaattatttgagggta
gaatgcgataaaacaaaattacaattgagttctaatgaggattcgataaataaagaagta
aatttatatggcgattatttaactattaaatgttgctatttaatgggaagaattgatgaa
gcagagcgtatgatccttaagatttgctcgaaacctctgacagagcttgctgatagttgt
ttaatttcaccctcagtttcaccaaaatcttggaaaggcactccagttacaaatgagaaa
aaaaaatcattatcctctatcttttcgacaatttgtatgaatcctacaatgctgatcaag
tacattcatactggagaattaaaaattccaggagattctgctgggctgtatttatgggga
aacattcttgaggaacttgatgccaaggtttctgctttatattgttatgcaattgctcta
gattggaatccagttttatggaaatcttttcaaaaactagtaggcctatcatgccagtat
cctcatgaacttgttaaaatatgttgttgcttgaataactggggcgagaagcatctagaa
tatgtgggcacaaacagcgatgctttggtaatatcaactgtgtataaaaacgaagccgag
tgttggcaggtaaaaaacattcaagatgggaatcttctgatatctatatcagataagtct
gattcggaagaattatatgtattaaatgtttctgatttcttttataatgttggtgatact
ttacaaaaaagacatatgctgagataccattcatttactaattggttggaaaatccagtt
aaagacggcaattctggcccaaaatggccatatagcgaatttgaagatgtaaagaatgca
aataataaatttagttcatcaaatattagtgaaattaattacaattcagttgcgtacaca
gagaatatagacgcaaacattaaacctcttgattcacgttttcatccattgatttctatg
attcagttgctgtcaaagtttacacatcagatggaatggtatctttgccatagctttctc
aaaaatattgaaagtattccaaacaaaatttcggaaatggggtatgtaagagagttgcat
gtaagggcacttttcgagtcaaatcaatggcaagaatgtataaacgtttgcaaatgtatt
aactatgaaaccaattataatctttggattaagtgtctcgatatttatagttcgtgtttg
tggcagttgtccaggagcattgacttaatcaatctttcaaacttgactttaaaaattatt
gaaaagaatacccctcagctttggattgtagttggaaattgcttttccttgcataaggaa
tacgaaagttcaattaagtgctttaaaagggcaattcagtatgataaccgctatgtttat
gcttatacattgattgggcatgagctttcaattattgagaaatacgatgaagcgatccaa
atgtaccaaaaggctttgaaaattgatccgaggtgccatagagctcactggggaatcggt
tatgtttggtttaaaagagaagagtactatcaagcaaagagccatttcaatttggcactt
aaagttgttccaaataattctacattaatacattaccttggcctttgctatctaacaact
catgattttctctctgcttataatactttccaaaagggaattctcaaagaccaaagaaat
ccttggttaaaatatcatgcaggaatcgtgttattagaactggaaagatatgaagaggct
ttaacaatgctgacagccgctcaccgcctcgcgtcaaacgaacccaatattcatctatat
ttaggaaagactttctcacatttaggcaggaaggataaggcattaagacacttaaacatt
gcatttgacttgactaaagacatcaatgagaagcagatcatattaaatctgatgaaggaa
cttgaaaatggctcaaatatagagggaaggtattgcaaatcaaacgaaactaatagaagt
gggaggatttcgaatagcggcgcaggatattcatcgggtagcaaactactttcttccttt
agaaatcatcactacttccctatcaggaacgatccacctaatccattcattcaccaccag
attcaacaagaacacaacatacctcaaactgtgccctctcctgcagtttcaggtggtcat
tctttattactaacattaatgccaggaaataattga

DBGET integrated database retrieval system