KEGG   Cryptosporidium parvum: cgd7_4080Help
Entry
cgd7_4080         CDS       T00168                                 

Definition
protein disulfide isomerase, signal peptide, ER retention motif
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cpv  Cryptosporidium parvum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    cgd7_4080
Enzymes [BR:cpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     cgd7_4080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 451 aa AA seqDB search
IFFTEDFLESFSIRLKVNTLQMRNLLKLILTLSFAPLFVTCLYDSSSQVKVINGSQLKKL
VKENPVVIVEFFAEWCGHCKAFAPEYEKAAKALKGIVPVVAIDDQSDMAEYGIQGFPTVK
VFTEHSVKPKDFTGPRRAESVLNAALSALKDVTNSRLSGKNSGNKGSNKTKESSKKSRKS
RVVELTDSNFDDLVINDNENSWFVKFYAPWCGHCKSLAPDWEELGSMADGRVKIAKLDAT
QHTMMAHRYKIQGFPTLLMFPAGEKREITPVNYNGPRTANDLFEFAIKFQSSSASIKQMI
SQEVFENTCTKGLCVIAFLPHIADSSDSEREKYLKIYKDVVSASAAMTIRFLWSEGGSQF
DFEEKLNLAFGYPAVVAINNEKQRFSTHRGSFTVESLNSFIIALTTGRAPVDPLPKLPKI
SKVSSWEPKKSKENSNAEENRNKSNRQSDEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
attttcttcacagaagactttttagaaagcttttcaatcagattgaaggtgaatacactg
caaatgaggaatcttctgaaactcatcttaacgctttcctttgctcctctatttgtgaca
tgcttatatgatagtagctcacaggtaaaagttattaatggctcacaacttaagaagtta
gttaaagaaaatcccgttgttatagtagaattttttgcagaatggtgtggacattgcaag
gcgtttgctccagaatatgaaaaagcagcaaaagctctcaaaggcatcgtccctgttgta
gctatagatgatcagagtgatatggctgaatatggtattcagggattcccaacagtgaaa
gtattcacagagcactccgtgaaaccaaaagatttcactggacctagaagagccgagtct
gttttaaacgctgctctttcagcacttaaagatgtaacaaactcgcgtctaagtggtaaa
aattcgggtaataagggatcaaacaagactaaggaatccagtaaaaagtcaagaaagtcc
agagttgttgagcttactgatagtaactttgacgatctagtaattaatgataatgagaat
tcttggttcgttaagttctatgcaccttggtgtgggcattgcaaaagccttgcccctgat
tgggaggagcttggaagtatggcagatggaagggtcaaaatcgccaagctggatgcaact
caacacacaatgatggctcatagatataaaattcaaggatttcccactttgttaatgttc
cctgcaggagaaaagagagaaattactccagttaattacaacgggcccagaacagctaat
gacctttttgaatttgcaataaaattccagtctagctctgcaagcatcaaacagatgatc
agccaggaagtttttgagaacacatgcacaaagggattgtgtgtaattgcattcctacct
cacatagcagactccagcgattctgagagagaaaaatacttaaagatatataaggatgtt
gtttcagcctcagctgcaatgacaattcggttcctttggtcagaggggggatctcagttc
gatttcgaagaaaagctgaacctcgcattcggatatcctgcagttgttgcaattaataac
gagaaacagagattttcaacacatagagggagcttcacagtagaatctcttaattcattt
attattgcattgaccacgggacgcgcccccgtggatcccttacccaagctaccaaagatt
tccaaagtaagttcctgggaaccaaagaaatcgaaagaaaattcaaatgctgaagagaat
agaaataaatcaaatcgtcagtctgacgaactataa

DBGET integrated database retrieval system