KEGG   Cryptosporidium parvum: cgd7_60Help
Entry
cgd7_60           CDS       T00168                                 

Definition
Hat1-like acetyltransferase (histone acetyltransferase-like)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     cgd7_60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
7
AA seq 423 aa AA seqDB search
MDDINPNKRVKLNEEPNSQLSIPIKIDNVLNKILLHPCETLNDFIENKVGSYAPYYAHHF
FHNEEIALLDGYNTLIHIYFSCNWFDVYVEVDLTAIKSKSKEHIELSEEDKNYYIENIIK
QLKTIPLEGGFCSKEEFMERLKIPLLWVPGTSAGIFKAGLRDEGIEEVDLRKIDLSETEN
LTSCLNKESNSSKPHPDVKNFQILHRRIEWFLHWYIESASSIDQEDRWAVWLPTVKREQS
LIILGLITTYLFFSIPKSRIRISQVLIFPQYQGKGLGCSFLDIIYSFAIKDEDIMEITVE
DPALSMMQLRDILTIEILLRNHVIKKDSLKPLKTDELLKILQNPNGSVNILKDVAMTCFP
SQTWEEVKEKIHKYTKESPRQIARLLVLISFFRYLPNPLPKIESNIEDEIRGFRVRKGKL
KII
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatgatataaaccctaataaacgagtaaagctcaacgaagagcctaactcacagcta
tccattccaattaaaattgataatgtattgaataaaattttacttcatccatgtgagaca
ttgaacgactttattgaaaataaagtaggatcttatgctccatattatgctcatcatttt
tttcacaatgaggaaattgcgttgctagatggttataatacgctaattcacatttatttc
tcttgcaattggtttgatgtatatgtggaagtagatttaactgcaataaaaagcaagtct
aaagagcatattgagttaagtgaggaggacaagaactactatatagaaaatattattaaa
cagttaaaaaccattcctctcgagggtggattttgttccaaagaagaatttatggaaaga
ttgaagattccattattatgggttcctggaacatcagcaggcatatttaaggcagggctt
cgagatgaagggattgaggaagtggatttaagaaaaatagatttatctgaaaccgaaaat
ctgacttcttgcctaaataaggaatccaatagttctaagcctcatcctgatgttaaaaac
tttcaaattctacacaggagaattgagtggttcctccattggtatattgaatccgcttct
tctattgatcaagaagataggtgggcagtttggctccctactgtcaaaagagaacaatca
cttatcattttaggtttaattactacatatttatttttttcaattcccaaatctagaatt
agaatttctcaagttttgatatttcctcagtaccaaggaaaaggtttaggttgttcattt
ctggatattatttatagctttgcaataaaagacgaagatataatggaaattactgtagaa
gatccagccctttcaatgatgcaacttcgtgatatattaactattgaaattttgctaaga
aatcatgtaattaaaaaggattctttaaaaccattaaaaactgacgaacttttaaaaatt
cttcaaaatccaaatggatcagtaaatattctaaaagatgtggcaatgacatgttttcct
tctcaaacttgggaagaagttaaagaaaagattcataagtatacaaaagagtcgccaaga
caaattgcaagattacttgtattaatatcattctttagatatttaccaaatccattaccc
aagattgaatccaatattgaagatgagatcaggggtttcagagtaagaaaaggtaagttg
aaaattatttga

DBGET integrated database retrieval system