KEGG   Cryptosporidium parvum: cgd7_60Help
Entry
cgd7_60           CDS       T00168                                 

Definition
(RefSeq) Hat1-like acetyltransferase (histone acetyltransferase-like)
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     cgd7_60
Chromosome and associated proteins [BR:cpv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    cgd7_60
   HAT complexes
    HATB complex
     cgd7_60
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N MOZ_SAS DUF148 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 3372029
NCBI-ProteinID: XP_628203
ApiDB_CryptoDB: cgd7_60
UniProt: Q5CZ27
Position
7
AA seq 423 aa AA seqDB search
MDDINPNKRVKLNEEPNSQLSIPIKIDNVLNKILLHPCETLNDFIENKVGSYAPYYAHHF
FHNEEIALLDGYNTLIHIYFSCNWFDVYVEVDLTAIKSKSKEHIELSEEDKNYYIENIIK
QLKTIPLEGGFCSKEEFMERLKIPLLWVPGTSAGIFKAGLRDEGIEEVDLRKIDLSETEN
LTSCLNKESNSSKPHPDVKNFQILHRRIEWFLHWYIESASSIDQEDRWAVWLPTVKREQS
LIILGLITTYLFFSIPKSRIRISQVLIFPQYQGKGLGCSFLDIIYSFAIKDEDIMEITVE
DPALSMMQLRDILTIEILLRNHVIKKDSLKPLKTDELLKILQNPNGSVNILKDVAMTCFP
SQTWEEVKEKIHKYTKESPRQIARLLVLISFFRYLPNPLPKIESNIEDEIRGFRVRKGKL
KII
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggatgatataaaccctaataaacgagtaaagctcaacgaagagcctaactcacagcta
tccattccaattaaaattgataatgtattgaataaaattttacttcatccatgtgagaca
ttgaacgactttattgaaaataaagtaggatcttatgctccatattatgctcatcatttt
tttcacaatgaggaaattgcgttgctagatggttataatacgctaattcacatttatttc
tcttgcaattggtttgatgtatatgtggaagtagatttaactgcaataaaaagcaagtct
aaagagcatattgagttaagtgaggaggacaagaactactatatagaaaatattattaaa
cagttaaaaaccattcctctcgagggtggattttgttccaaagaagaatttatggaaaga
ttgaagattccattattatgggttcctggaacatcagcaggcatatttaaggcagggctt
cgagatgaagggattgaggaagtggatttaagaaaaatagatttatctgaaaccgaaaat
ctgacttcttgcctaaataaggaatccaatagttctaagcctcatcctgatgttaaaaac
tttcaaattctacacaggagaattgagtggttcctccattggtatattgaatccgcttct
tctattgatcaagaagataggtgggcagtttggctccctactgtcaaaagagaacaatca
cttatcattttaggtttaattactacatatttatttttttcaattcccaaatctagaatt
agaatttctcaagttttgatatttcctcagtaccaaggaaaaggtttaggttgttcattt
ctggatattatttatagctttgcaataaaagacgaagatataatggaaattactgtagaa
gatccagccctttcaatgatgcaacttcgtgatatattaactattgaaattttgctaaga
aatcatgtaattaaaaaggattctttaaaaccattaaaaactgacgaacttttaaaaatt
cttcaaaatccaaatggatcagtaaatattctaaaagatgtggcaatgacatgttttcct
tctcaaacttgggaagaagttaaagaaaagattcataagtatacaaaagagtcgccaaga
caaattgcaagattacttgtattaatatcattctttagatatttaccaaatccattaccc
aagattgaatccaatattgaagatgagatcaggggtttcagagtaagaaaaggtaagttg
aaaattatttga

DBGET integrated database retrieval system