KEGG   Cryptosporidium parvum: cgd8_1270Help
Entry
cgd8_1270         CDS       T00168                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
cpv  Cryptosporidium parvum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    cgd8_1270
Exosome [BR:cpv04147]
 Exosomal proteins
  Proteins found in most exosomes
   cgd8_1270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 2007 aa AA seqDB search
MQNKGGIPITTNVLANLEELGINSSCFRFGSLTLEGDKYVGVKETSVDGGSQIVVIDTQS
KGINRKPMKAESALIHPIENILVVRGRYEDNGCTVQIFNLDSKEKLGAFLFPESVVFWRW
LTPRILAIVGDKGIYHWTIESGNSNSIPVRIFERAGKLAEQSTQIVGYQTDSGQRWCMLM
GLCPVTNESTGSISVKGQLQLFSVEKRQQQLIEGFSGNFGELIVDDFVHSPASIVCFVEK
KQEHSNARLHVMDISGQRAGSGEFGSSLSPPTPFKAVIELPTVDEGSAGGAHSFDFPIYT
YVSSYFGVIFIITRGGILYIVEPTSNTLLYCNKVCQDSVFLGSPSRFHGICMANKKGLVL
HITLNSSSVLTYIQSNPELSLNSNLLRWTQRYGYQGTDEFSIRMFNESIKRQDYQNACRV
VSLNKNGSLRTPATLNHFKMVDSSNKLLFQYFTTVFKFHTLNQFESTEFCRLLLSPNSTS
LISEFTSITQPLAFLQVLINEEKLAFSEELGDTLLQNGEKKLALKIFKKCTPQNPTKILQ
TLIEIGNFSHVSEFIREQRASNWPTITTDIRSLLNSLLIANNIDATVEFVKTVILPPAPS
SQTDLANSTSAESLDLNIDKTSVVEIFVSHSRYKEITSILLDHLKANKPEDSALQTKLLE
VNLLHAPQVAEALFQMDLFTHYDKHAIAALCEKAGLYERALENFSDMRDIRRILGVACGS
LNTDWLANYLSKLSPRTRFDCLKELLLVCKNSSGAGGLVSMGGGLASNGALPGNGQAGLI
GNSSSNSIALSNNNTVLQSVIQVCIKNVDNIGIENIITLFEQQGIWEGIYYVVGSNLTQY
LSGNSLSSSGSTDSLNLSSESLIGDSGTQNRGGAGVVLAGSGRLPSSNTGSVNGGTGSFS
TFIVFKYIEASVHLGQIQEAERICRDFPQSYEPEQVIEYFKSIKMSDLRPLIWVCDLHHR
VEELISYLYHMSLYKYIQVYTLKINPSQTPLVIGTLIDLDGSEDLVKSLLQEIKTLGSSF
SFGELIQQAENRNRLKLLLSWLEERVQEGYQDPALHNALAKIYIDMNKDSENFLKTNPHY
DAKTIGDYCEDRDPYLAYIAYRKAWGQCDDEIIQVTYKNDLYRLLARYLVERQDLDLWNK
VLGNSSNSIEPVVNEQCRQAIIDQVTSSILPEFYNKSEEISCVIRAFINAEVPNSLLEVL
EKIIFHVNNTEFSQNKNLQNLLLLTSIKIDVRRLDDYVLRLDNYDAKEVAKVAIDHGLYS
HAFQIYKKFSFNNEAVETLLMISKLELLKNEGIEIDGQGSEFMKNLDSMISIEKLANMDL
SKVQDFASYCNDNSVWDVLGQQYLKISRTKDAVDCFIKSENTRDYRLIIEHCLSVKAYRE
LLGYLQMVRRLKDSRTSKDPIVDTELAYCMSKLELLQDLQSFLQGINTVQLQKIGDRLMD
EQDYRYSIIFYQAIPNYSRLTSCYIQLGEYNNALETAKKANSPKTWKELLQICMQIGESE
LAHQAGLNIIVYPDYCEDVVSEYEKKGLTAELLTLLEGAIQNTDRANGSLFTELGILYAK
YTPEKLMDYCSSYSGRINIPKLTRICEQRQLWNEVVYLYLQYQEFDQAVLTVISHPKEAW
KNDQFLSILQNVTNVDILYKSMTFYLQEHPELLNSLLMLTLKPKKSSEMIPKSNSSDISD
YSPTKSTSGAHSQSGTGRSGSNFDLANITTRFIQQYFSQGLSSTSSNTVGPITGISPRPS
VGKESGTQSGSNYDISIIQEFLESISDENIQVVNEALINLYIEKVEVEKLMKLILTCDNY
DQAKLSARLEKHPMNDLRKLAVKILDKNSNYQQALSICQKEMLIDEAILVVYKSGNVALI
EELLEFLLSNNKKENFVACLYTCYEFLRPDTVMEMAWKHNCLDATMPFFIQSLRDMTNRI
DVLEKKLETLQITDIATTASGGHPSVSNSQNISSCVDMGPNSSISPGLISSHHHVNNNNS
NNNSNSNSSNTINNNYHLMSNNKLIFH
NT seq 6024 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacaagggaggaatccctattactaccaatgtattggcaaatttggaggaactt
ggaatcaattcatcatgttttcgatttggtagcctgacattggaaggagataaatatgtc
ggtgtaaaggaaacaagtgttgatggcggttcacagattgttgtgattgatactcaatct
aaaggaataaatagaaagccaatgaaagcagaaagcgctttaatacatcccattgaaaat
attctagtagtcagaggaagatatgaagataatggttgtacagtccaaatctttaatcta
gactctaaagagaagcttggagcattcttatttcctgaatctgtagtattttggagatgg
ttgactccaagaattctagcaattgttggtgataagggtatatatcactggacaatagaa
tcaggaaattctaattcaattcctgttcgaatttttgagagagctggaaaattagcagaa
caatcaactcaaattgttggatatcagacagactctggccaaagatggtgtatgcttatg
ggactttgcccagtaacaaatgagtcaactgggtcaatttccgttaaaggccagcttcaa
ttattttcagtagaaaaacgtcaacaacaacttattgaagggttttctggtaactttgga
gagcttattgttgatgattttgtacattctccagcatcaattgtctgctttgtcgagaag
aaacaagaacattcaaatgctagacttcatgtaatggatatttcaggccaaagagcagga
tctggtgaattcgggtcatcattatctcctccaacaccattcaaagctgttattgaactt
ccaactgtagatgaaggctcagctggaggtgcacatagctttgactttccaatatatact
tatgtttcaagttactttggagtcatattcattattacaagaggtggaattctgtatatc
gtggagccaacatcaaatactttgctttattgcaataaggtctgccaggattctgtgttt
ttaggttctccaagccgttttcacgggatttgtatggcaaataaaaaaggactggttctc
catattactttaaatagctcatcagttcttacatatatccaatcaaatcctgaattatct
ctaaattcaaatcttcttagatggactcagaggtacggttatcagggaacagatgaattc
tcaattaggatgttcaatgaatcaattaagagacaagactatcaaaatgcttgtagagtt
gtttctcttaataaaaatgggagcttaagaactcctgcaactcttaatcacttcaaaatg
gttgattcttcgaataagttattattccagtactttacaactgtattcaaatttcacact
ttaaaccaatttgaaagtactgagttttgtagactattactttctccaaattctacaagt
ttaatttcagaatttacctccattacacaacctttagctttcttacaagtcctaataaat
gaagaaaagttagctttctctgaagaacttggagatacactacttcagaatggcgaaaag
aaacttgctcttaagatttttaaaaaatgtactcctcaaaatccaaccaaaatcttacaa
acacttattgaaattggtaatttctcacatgtttcagaatttattcgtgaacagagagct
tcaaactggcctactattactactgatatcaggtcattactcaacagtcttttaattgct
aacaatattgatgctactgttgagtttgttaaaacagttatactccctcctgctccttca
tcccaaacagatctggccaattccacctctgctgaatctcttgatcttaatatagataaa
acttcagtcgttgagatttttgtatcccattctagatataaggaaatcacttctatcctt
ctagaccatctcaaagctaataaaccagaagattctgccctccaaacaaaactacttgaa
gttaatctccttcatgctccacaagttgctgaagcccttttccaaatggaccttttcact
cattatgacaagcatgcaattgccgccctttgcgaaaaggcgggtctctatgagagggct
cttgagaatttctctgacatgcgtgatataaggagaatattaggagtagcttgtgggagt
ttaaataccgattggctggcaaattacttatctaaattaagtccaaggacaagatttgat
tgtttgaaggagctactgttggtttgcaagaatagtagtggggcaggtggattagtttcc
atgggaggtggattagcgtctaatggagcattaccaggtaatggacaagcagggttaata
ggaaacagttcatcaaattcgatagcattaagtaataataacaccgttttacagagtgtc
attcaggtatgtattaagaatgtggataatataggaatagagaatattattactttattt
gaacaacagggaatttgggaaggcatttactatgttgtagggtcaaatctgactcagtat
ttatctggaaatagcttatcttcatctggttctactgattctttgaatttgtctagtgaa
agcttaataggagattctggtactcaaaatagaggaggggctggagtggttctggcagga
tcgggaagattaccatcttctaatacaggatcggttaatggtggaacaggatcattttct
acctttattgtattcaagtatattgaagcttcagtccatcttggccagatccaagaggct
gagaggatttgcagggatttcccacaatcttacgaaccagaacaagtcatcgagtacttt
aagagcattaagatgagcgatttaagaccattaatttgggtttgtgatcttcatcaccgt
gtagaagaattgattagttacttgtaccatatgtcactttataagtacatacaggtttat
actttgaagattaatccaagtcaaactcctttggttatcggtaccttaatagatcttgat
ggatctgaggatttagttaaatctcttttacaagagatcaagactttaggatcctcattc
tcctttggagagctaattcaacaagcagaaaacagaaatcgtctcaagttattgttatct
tggcttgaagaaagagttcaagaagggtaccaagatccagctttacataatgctttggca
aagatttatattgatatgaataaggattccgagaatttccttaagactaatcctcattat
gacgcaaaaactattggagattattgtgaagatagagatccttatcttgcatatattgct
tatagaaaggcttggggacaatgcgatgatgaaattatacaagttacctacaaaaatgat
ttatatcgtttattagctaggtaccttgttgaacgtcaagatcttgatctttggaataaa
gttttgggaaattcttcgaattctattgaacctgttgttaatgagcagtgtagacaagct
attattgatcaggttacttcttcaatattaccagagttctataataaatctgaagaaatt
agctgtgtaattagggcatttattaatgcagaggtaccgaattcattattagaagttttg
gagaagattatcttccatgttaataacactgaattttctcagaataagaaccttcaaaat
cttcttttattaacttctattaagatagatgttcgaagattggatgattacgtactcaga
ttagataattatgatgctaaggaggtggccaaagttgcaatagatcatgggctttattca
catgcttttcagatctataagaagttctcttttaataatgaggctgttgagaccttatta
atgatttcaaagcttgaattgttaaagaatgagggtattgaaattgatggacaaggatct
gagtttatgaaaaacttggattctatgattagtattgaaaaattggctaatatggatcta
tctaaggttcaggattttgcatcctattgcaatgataactctgtttgggatgttcttggt
caacaatatctaaagatttctcgaacaaaggacgctgttgattgctttattaaatctgag
aacaccagagattatagacttattattgaacattgtctctcagttaaagcttatcgagaa
ctattggggtatttacaaatggttcgaagattgaaagattctagaacatccaaagaccca
attgttgatacagaattagcttactgtatgtctaagttggagcttttgcaagatctccaa
agcttcttacaaggtattaacacagtacaacttcaaaaaattggagatagacttatggat
gaacaagattatagatactcaatcattttctatcaggcaataccaaattactcaaggctt
actagttgctatattcaacttggagagtacaataacgctttggaaactgctaagaaggca
aactctcctaaaacttggaaggagcttttgcagatttgtatgcagattggtgaatctgag
ttagcacatcaagctggacttaacataatagtgtatccagattactgtgaggatgtggta
tctgaatatgagaagaagggtctcacagctgagcttctaactctattagaaggagctatt
caaaacacagatcgtgctaatggtagccttttcacagaacttggaatactttatgcaaag
tatactcctgaaaagcttatggattattgttcttcttactcaggaagaattaacatccca
aagcttactaggatctgtgagcaaagacagctttggaatgaggtggtatacctttacctc
caatatcaagagtttgatcaagcagttttaacagtaataagtcatccaaaagaggcatgg
aagaatgatcaattcctaagtatactacaaaacgttacaaatgtggatattctctataaa
tcaatgactttctatctacaagagcatccagaattgctaaatagtttattaatgttaact
ttaaagcctaaaaaaagttctgaaatgataccaaagtcgaactctagtgatatatcagac
tattctcccactaaatcaacaagtggagctcatagtcaatcagggacaggaagatctgga
agcaattttgatcttgctaatattactactagatttattcaacagtattttagtcaagga
ctttcttcaacaagctctaatacagtgggtccaattacagggatttctccaagaccttca
gttgggaaagaaagtggaacacagagtggatctaattacgatatttcaataattcaagaa
ttcttagaatctattagtgatgagaacattcaagttgtgaatgaggctttgattaattta
tacatagagaaggtggaagttgaaaagctgatgaaattaattttaacttgcgacaactat
gaccaggcaaaactttcagccagattagaaaagcatccaatgaatgatttaagaaaactt
gcagtgaagatcttagataagaattcaaattatcaacaagctctttcaatttgtcagaaa
gagatgctaatagatgaagcaatcttagtggtttacaagagtggcaatgttgctcttatt
gaagaacttttggaattcctccttagtaataacaagaaggagaactttgtagcttgttta
tatacatgctatgagtttttaagaccagatactgtaatggaaatggcttggaaacataat
tgtctggatgctacaatgccatttttcatacaaagtcttagagatatgaccaatagaatt
gatgtccttgaaaagaagcttgaaactcttcaaattactgacattgcaactacggcttct
ggcggtcatccaagtgtttctaactcacaaaacatttcaagttgcgttgacatggggccc
aattcttcaatttctcctggtctgatttcatctcatcatcatgtgaacaataacaacagt
aataataactcaaattctaactcttccaatacaataaataataattatcatctaatgtca
aacaataaattaatctttcactag

DBGET integrated database retrieval system