KEGG   Cryptosporidium parvum: cgd8_1530Help
Entry
cgd8_1530         CDS       T00168                                 

Definition
ubiquitin carboxyl terminal hydrolase domain that is fused to a MATH domain
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     cgd8_1530
Peptidases [BR:cpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   cgd8_1530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 1607 aa AA seqDB search
MHTGRNIERPSMEGFSSREKQYDYSNIPGRLQNELEFKVEGFRRRIMEMMNSTEGGTKNR
LYSNIHSYKNFNFRIMILPKVKLTSGGSLEGHISAYLEAIPSQNWPSNWVWLNTRYSVTL
INQKDYRKSHFMSDIFSFKGENDPKKKLTLEERNYDYSSAGPEADRGWSDFFSLKTLLDP
KTGFIDSETETVIFRAGVFPVLCDPVSCGKSNFDHLGTDRSLTGYVGIRNLGATCYMNSL
LQSLYHIGRFRKAVYTIPLNPNRVTSGSSCSNTPISRETRPELTPLSACIPKIDDFGEVT
PQSISSESNSLAISLLGEASEDAVEWTSNVAKSLFEYESDGIASLESIMSSNACQDYGQN
TGVVSGNVSGPGSTIGGNCSASDAGNDQTKISSALQTLFYELQTCSEPVNCRELMRSFGW
DASDAFTQHDAQELNRLLCDRLEEEMKNTAVDGSIKALFEGEYENYIECLDVDCTSRRRE
NFYDIQVDVEGVKSLEESLQRFVEEEILDGENLYEAEGFGKQRAKKGVRFQRFPPVVQFH
LKRFQFNIQSMDMVKLNDYFTFPEKLDLSSFVNHNNKGETDTGNIVEGTEKYILHTVVIH
QGDVHSGHYYAYIRPKPDSDWFRFDDEKVTLVSSSTAIEDNFGGHEYEVWDYLGNPESDI
PKRSKTHSAYILVYVREDQAQDLLSEPIPQEVNPDLVSKYRKEIEMMNLRKRLRQDLNEH
VRIQLLLSTSYNISSSCRPKSQGLHQSISSFPWNYIFKCSRDFSLSQFHSELEKRFLNKR
MLHNDVPSSSISCNKAFGSHLFLLETNPEGNHTASGGARGMGGLHHHIGYSNGGPTSSTG
LSFYTCISSPQGEGISSGNRISDSQRGGAGGMLGRAIGFGSSTSGTRSGDEILMSDLCRR
YHRAGLWDSSCPTLYMCLYLDDVSSLLMDRIPPNLPINADGSYLEKRQRIENKLRNFNDN
GGGEVLLLLRYFDISNPRINEFSLKYSRNQEIPNLYNLGLIMVSQSTTLKDLNEYVMMEI
EKDKDNKSPGRGLISGFEFGLRVCLETASDSDNLFPLLDPRCTIQQLQLINGSSLIFSIN
LDDSVINRKREELRKSLEEVVIFPNQNLWLQEEKTSQYNGIEDEGKSSESEDSSFRLPVE
LEMVKCPEFPVLDFHHWYENFQNSLHLSLYLWDPLDGEYHPPHLGGGGGGGGTHLCLPNT
NQYGIMEAMQASNNSIIRSFSRYQIKEVHQIHVDLRWPAIKTWIYVCNQIKVDPRSIALA
RNALNPLDASLLTLFSLIQAQRHDESISSVIRSLSSAHYYGKIPRSLAILALNLKGHSFV
SLNRKDKHILTVTNTVNCSEIPKGRYILQVESCDTVDSVIRKLIKKENILSHRSFNTNGK
DAMQTGNGAKSHTDISKLKLRLFEASNQNDHVGVYRGGEMITRILNTDGMQNTSTFGGLS
IGSFVDCFRIEQDYSQEELDLLKKGELVNILVIQDSRSGFGGNYGDHYHNDDHNSLAGGT
SYLVTIPVSSRLVDLKNKLQERFDLDEKIISKWRFYRLESKSLQGIKDNDLIMNSFGNNG
VGINNHYSTNAKNNVDINIYGFEPHTILLAQQVFPILQKSGSRPLKI
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgggcgtaatatagagaggccgtccatggaaggcttctcgagtagagaaaaa
cagtatgactactcgaatataccaggacggcttcaaaatgaattggagtttaaggttgag
ggttttagaagaaggattatggagatgatgaacagtaccgaggggggtacgaagaaccga
ctatattcaaatattcacagttataaaaactttaattttcgaataatgattcttccaaag
gttaaattgactagtggaggttcgttagaaggtcatatttctgcttatttggaggcaatc
ccatcgcaaaattggccttcaaactgggtatggttgaatacaagatattctgtgacctta
attaaccaaaaagattacagaaaatctcactttatgagtgatatattcagctttaaagga
gaaaatgacccaaagaagaaacttacattggaggagagaaattatgactatagctctgca
ggcccagaagccgatcgtggttggagtgatttttttagcttaaagactctcttggatcca
aaaactggttttattgattctgagacagaaacagtaattttcagagctggtgtatttccg
gttttatgtgatccagtttcgtgtggaaagtcaaattttgaccatttgggaactgatcga
tcactaactggatatgttggaattcgaaaccttggagctacatgttatatgaactcccta
ctacaatctctatatcatattggaagattcagaaaagctgtctatactattcccctgaac
ccaaatagagtcacatcaggctcatcatgttctaatactccgataagtagagaaacaaga
cctgaattaactcctttgagtgcttgtattcctaagatagatgatttcggagaggtcact
cctcaaagtattagttctgaatctaatagccttgccatttctttattgggagaagcctca
gaggatgctgtagaatggaccagtaatgttgcaaaaagtctttttgagtatgaaagtgat
ggtattgctagtcttgaaagtattatgtcttcaaatgcatgccaagattatggacagaat
accggtgtagtaagcggtaatgtatctggtccgggatctacaataggaggaaactgctca
gcttcggatgctggaaatgatcaaacgaagattagttctgctctccaaaccttattttac
gagcttcaaacctgttcagaacctgtgaattgtcgtgaactgatgagatcttttggctgg
gatgcttcagatgcattcacccaacatgatgcacaagagttaaatagactactttgtgac
cgtcttgaggaggaaatgaagaatactgctgttgatgggagcattaaagctctttttgaa
ggagagtatgaaaattatatcgagtgcttggatgttgattgtacttctagaaggagagaa
aacttttacgacattcaagttgatgttgaaggagtaaagtcattagaggaaagtctccag
cgttttgtagaggaagaaattttggatggtgaaaacctctatgaggctgagggctttgga
aaacagagagcaaagaagggagttagattccaaagattcccacctgttgttcagttccat
ttgaagagattccaattcaatattcaaagtatggatatggtcaagttgaatgattacttt
acttttccagaaaaattggatctatctagctttgtgaatcataataataaaggagaaaca
gatactggtaatattgtagaaggtaccgaaaagtatatattacatactgttgtcattcat
cagggggatgttcatagtggacattattatgcctatatacgtccaaaacctgattcagac
tggtttagatttgacgatgaaaaggttactctagtttcatcttctacagctattgaagat
aattttggaggccatgagtatgaagtttgggattatttgggaaacccagaaagtgatatt
ccaaaaagatccaaaacccactcagcttacatcttggtatatgttagggaggaccaagct
caagatttgctttcggagccaattcctcaggaggtcaatcctgatttagtttctaaatac
agaaaagagattgagatgatgaatcttcgaaagagacttagacaagatctgaatgagcat
gttcgaattcaattattgttatcaacaagttataatatctcatcctcttgtcgtccaaaa
tcccaaggtcttcatcaaagtatttcatccttcccatggaattacatattcaaatgttca
agggacttttctttgtctcagttccattctgagcttgaaaaaagattcttgaacaaaagg
atgcttcataatgatgttcctagtagtagtattagttgtaataaagcttttggatctcat
ttattccttctggaaaccaacccggagggaaaccacactgcttcaggaggagcaagagga
atgggtggattacatcatcatattggatactcaaatggaggccctacatcctcaaccggt
ctatccttttatacatgcatttcatctccccaaggagagggaattagctctggaaaccgg
atatcagattctcaaagaggcggagctggtggaatgctaggtagagctattggatttgga
agttcaacttctggtacaagatcaggagatgagatcttaatgtcggatctatgtagaaga
taccatcgtgcaggcctttgggactcatcttgcccaactttatatatgtgtttgtatctt
gatgatgtctcaagcttattaatggaccgaatccctccaaatctaccaattaatgcagat
ggttcatatttagagaagagacaaaggattgaaaataagctcagaaactttaatgataat
ggaggaggagaagttttgcttctcttgagatattttgatatctcaaaccctaggatcaat
gaattctccttaaaatactctagaaatcaggagattccaaatctttataatctaggactt
atcatggtttctcaaagcaccacacttaaggatttaaatgaatatgtaatgatggagata
gaaaaagataaagataacaagtcaccaggtagaggattgattagtggctttgagtttgga
cttagagtatgtctggaaacggcttcagatagtgataatttgttcccattattggatcct
cgatgtacaattcaacaacttcagcttatcaatggatccagtttaatcttttcaataaat
ttggatgattcagtaattaatagaaagagagaagaattaaggaaatctcttgaagaggtt
gtgatcttcccaaatcaaaacctttggttgcaagaagagaaaacttctcaatataatgga
attgaagatgaaggaaaatcttctgaatcggaagattctagtttcaggcttccagtagaa
ctagagatggttaagtgcccagaatttccagttttggactttcatcactggtatgaaaat
ttccagaattctctccatctttctctatatctatgggatcctctagatggtgaatatcac
ccgcctcatttgggaggaggaggaggaggaggaggaacgcatttgtgcctgcctaataca
aatcaatatggaataatggaagccatgcaggcgagcaataatagtataatacgctcgttt
tcaaggtatcaaattaaagaagtacatcaaattcatgtggatctccgctggccagctatt
aagacttggatttatgtttgtaatcaaatcaaagtagatcctagaagtattgctttagca
agaaatgcactgaatccactagatgcttctttgctaactttattctctctgattcaagcc
cagagacatgatgaatctatatcttcagtaatcagaagcttaagttcagcacattattat
ggaaaaataccacgttctttagctatcctggctctaaatctgaaaggtcactcctttgtt
agtttaaacagaaaagataagcatattctaactgtgaccaatactgtaaattgttctgaa
atacctaaaggaagatacatccttcaggtagaatcctgtgatactgtggattcagtcata
cgcaagttaataaagaaggaaaatattttatctcacaggtcctttaatacaaatggtaag
gatgccatgcaaaccggaaatggcgccaaaagtcacacagatatttccaagcttaaatta
agattattcgaagcgagtaaccaaaatgatcatgttggtgtatatcgaggaggggaaatg
ataacaaggattttaaacacagatggaatgcaaaatacttctacttttggaggattatct
attggctcttttgtggattgctttaggattgaacaagattattcacaagaagagttggat
ttacttaaaaaaggagagttagtaaatattttggttattcaggattcaaggagtggtttt
ggcgggaactatggagatcattaccataatgatgatcataattcattggctggaggtaca
agctatttagtaacaataccagtaagttcaagattggtagatttaaagaataaactacaa
gaaaggtttgatttggacgagaagataatatccaaatggagattttaccgtcttgagtca
aagagtcttcaaggaattaaggataatgatttaattatgaatagttttggaaataatggt
gttggtattaataatcactatagcacaaatgcaaagaataacgtggacattaatatatat
ggttttgagcctcatacaattttattggctcaacaagtttttccaattctacaaaagagt
ggctctagacctctgaaaatttaa

DBGET integrated database retrieval system