KEGG   Cryptosporidium parvum: cgd8_1720Help
Entry
cgd8_1720         CDS       T00168                                 

Definition
acetaldehyde reductase plus alcohol dehydrogenase (AdhE) of possible bacterial origin
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpv  Cryptosporidium parvum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cgd8_1720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cgd8_1720
   00620 Pyruvate metabolism
    cgd8_1720
   00650 Butanoate metabolism
    cgd8_1720
  Lipid metabolism
   00071 Fatty acid degradation
    cgd8_1720
  Amino acid metabolism
   00350 Tyrosine metabolism
    cgd8_1720
Enzymes [BR:cpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cgd8_1720
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     cgd8_1720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 867 aa AA seqDB search
LKVEVAQKAFLKLSQEQVDYIFQRASLAANCARYELAVLAIEDGGMGLLEDKIIKNHFAS
ENIYNKYRNTKTVGVIEHDEFGGIDIVAEPLGILAGISPCTNPTSTTIFKSLISLKTRNC
IVFSPHPRTARSSIRAAKIIRDAAIEAGAPEDCIGWIDVASISLCNSLMNHSSVSAILAT
GSVALVKAAYSCGKPALGGGAGNSPVLVDELSDLEMVVNSVILSKTFDNSLICASEQCLV
VLDSVYDKLISGFKNRGVHIISSKDELQRLGNLLIDENGNMNPKSVGISAVEIAKMASID
IPKDAVMILAEINEIGRGEKLSHEKLCPVLSIIRASDFNDGVSKAKALVEFGGLGHTSCI
YTDPNSDEGKRRITEFQRSIPTGRVLVCMPAAQGAMGEMFNFRQTPSLTLGCGSWGHTST
AEGIGVKHLLNYKQVVQRRDHISWFKVPPSIYFNRGCLEEALQDLKEINLKKAYIITDRV
MVSLGFVDNLIEGLKSVGVASEMFAEVPPEPDVETVKEIVKRLNVSKPDCLIGFGGGSPM
DASKLVRLMYEHPTVKWNEVVTRFMDIRKRIVKLPPSGGKIQRFICIPTTSGTGAEMTPF
AVITDNSTGIKYPIASYKLTPDMAIVDANFVLSMPRFLAAATGLDALTHALEAFVATYAS
EYTDGLCIQAMRLIFDHLPNSVINADAKAREYVHNASSIAGMAFSNAFLGICHALAHQLG
AQMHIPHGIANAILLPHIISYNASNRPTKQSILSQYKYPVAKSRYAKLVDILHFKSNQSF
DSNLDQESINIRILVEAIQNLKKTLQVPMCVKDHGIEEEHYMSKVESMSIHALDDQCVGA
NPRFPLLNEIKQLYIDAYSGFVRYPEH
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
ttaaaggtggaagtagctcagaaagcttttttaaaactttctcaagagcaagttgattat
atttttcaaagagcttccttggcagcaaactgtgcaagatatgagttggcagtattagca
atagaagatggtggaatgggattgttagaggataagataataaagaatcactttgcatca
gagaatatttataataagtacagaaatacaaagactgtaggagtaattgaacatgatgaa
tttggaggaattgatattgttgctgaaccattgggaattttggcaggaatctctccatgt
acaaatccaacatctacaacgatcttcaaatccctcatctcccttaagacaagaaactgc
atagtattttctcctcatccaagaactgctagaagctccataagagcagccaaaattatc
agggatgcagcaatagaagcaggagctccagaggattgtattggttggatcgatgttgca
agtatttccttatgtaattccttaatgaaccatagctctgtcagtgccattctagcaaca
ggttcagtggctttggtgaaggcagcttattcatgtggaaaaccagccttgggaggagga
gcaggaaattcaccagtattagttgatgaactctcagatttggaaatggttgtgaactca
gtaattttatccaaaacatttgataacagtttaatttgcgcatccgaacaatgtttggtg
gttctagattcagtatatgataagttgatttctggattcaaaaatagaggagtacatatc
atttcttcaaaagatgagctccagagacttgggaatttattaattgacgaaaatggaaat
atgaatcctaaatctgttggaattagtgcagttgaaatcgcaaagatggcatccattgat
atcccaaaagatgctgttatgattcttgctgaaatcaacgaaattggaagaggggagaaa
ctgtctcacgaaaagttgtgtcctgtattgtcaatcatcagagctagcgactttaatgat
ggtgtttccaaggcaaaagccttagttgaatttggtggtttgggacacacatcttgtata
tatactgacccaaattctgatgaaggaaaacgcagaattactgagttccagagaagcatt
cccactggaagagttctagtttgcatgccagctgctcaaggagcaatgggtgaaatgttt
aacttccgtcaaactccttctttgactttgggatgtggttcctggggccatacttcaaca
gctgagggaattggtgtaaaacatttgcttaattacaagcaagttgtacaaagaagggac
cacatctcctggtttaaggttccaccttctatttatttcaatagaggatgccttgaagaa
gctttacaagatctcaaagaaatcaatttaaagaaagcctacattattactgatagagtc
atggttagtcttgggtttgttgataatcttattgaaggtctcaagtctgtaggagtagcc
tctgagatgtttgcagaagtccctcctgaacctgatgttgaaactgtcaaggaaattgtt
aaaagattaaatgtaagcaaaccagattgtcttattggttttggaggaggctctcctatg
gacgcttccaagcttgtaaggcttatgtatgaacatccaactgtcaaatggaatgaagtt
gttactagatttatggatattagaaagagaattgtcaaactacctcccagcggtggaaaa
attcaaagatttatttgtattcctactacttctggtactggagcagaaatgactccattt
gctgtaattactgataacagcactggaatcaaatatcctattgcttcttacaagcttact
cctgatatggccattgttgatgccaactttgttctttctatgccaaggttccttgcagct
gcaactggcttagatgctctaacacatgcccttgaagcttttgttgcaacctatgcttct
gaatacactgatggactttgcattcaagctatgagacttatattcgatcatttgccaaac
tctgttatcaatgcagatgccaaggcaagagaatatgtacacaatgcttcatctattgct
ggtatggcattctcaaatgcttttcttggaatttgccatgctctagctcaccaactggga
gctcaaatgcatattccacatggaattgcaaatgcaatacttttaccacatattatttct
tacaatgcatctaatagaccaacaaaacagtccattctatctcagtacaagtatcctgta
gcaaagagtagatatgcaaagcttgttgatatcttgcatttcaagtccaatcagagcttt
gatagtaatttggatcaagagagtattaatattagaattctagttgaagcaatacaaaat
ctcaagaaaacattacaagttccaatgtgtgttaaagatcatggaatagaggaagaacat
tatatgtcaaaagttgagtctatgagtatccatgctcttgatgatcaatgtgtgggagct
aatccaagattccctcttttaaatgagattaaacaactctatattgacgcttattctgga
tttgtcagatatccagaacattaa

DBGET integrated database retrieval system