KEGG   Cryptosporidium parvum: cgd8_3200Help
Entry
cgd8_3200         CDS       T00168                                 

Definition
ubiquitin C-terminal hydrolase of the cysteine proteinase fold
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     cgd8_3200
Peptidases [BR:cpv01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   cgd8_3200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 227 aa AA seqDB search
MNKKNKIWKPLISDPKLLEEYSVGLGVKSKISFIDIYTTEETEFYFCGINPISLIALVPI
NDEKICKKRNKLGCEMNISQSVWFMKQYITNSCSAVALLHSILNNDKIELEEESIAKMLL
NLKGDPNDLPEERGFYLINDKNIEYLHEELSSRDLTKDCDQSEFHYVSFVNNHGHIIELD
GRLPCPISHGVCKSDEFLKNTLKIIKENFILPIGINGKIAIVALCIK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaaacaaaatatggaaacctcttatttctgatccaaaattacttgaagag
tattccgttggattaggtgttaaatctaaaattagctttattgatatttacacaacagaa
gagactgaattttatttttgtggtataaatccaatttctttaatagctttagtaccaatt
aatgatgaaaaaatttgcaaaaagagaaataaattaggatgtgaaatgaatatctcccag
agcgtttggttcatgaaacaatacattacgaattcttgcagtgcagttgcgcttttacat
tcaattttgaataatgataaaatagaacttgaagaagaaagcatcgctaaaatgttattg
aatttaaaaggtgatccaaatgatctacccgaagaaagagggttttatttaataaatgac
aagaatattgagtatctacacgaagaattatcatcaagagatctaactaaggactgtgat
caatcagagttccattatgtatcttttgtaaataatcatgggcatataatagaattagat
ggaaggcttccctgtccaattagccacggagtatgcaaaagtgatgaatttcttaaaaac
acactaaaaatcataaaagaaaattttattttgccaataggaataaatggcaaaatagct
attgttgcattgtgtataaaatag

DBGET integrated database retrieval system