KEGG   Cryptosporidium parvum: cgd8_4340Help
Entry
cgd8_4340         CDS       T00168                                 

Definition
ubiquitin carboxyl-terminal hydrolase of the cysteine proteinase fold
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cpv  Cryptosporidium parvum
Brite
Enzymes [BR:cpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     cgd8_4340
Peptidases [BR:cpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   cgd8_4340
Transcription machinery [BR:cpv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     cgd8_4340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 765 aa AA seqDB search
MASILSQEAEKRQDSHPVTLQLSNRLVNFVSGGFLANKTGIESSSYVSDNSQISDKTQKH
MDKLKEKEQIENNVPLAKPEYYYFPPELLTDARDFLEPKEISHFRPYGRGLANPGWNTCY
FNSILQALTYAPYLSIDCLRRNHQKICKHMKDHLVCIMCMFEDHVNIMLDNTSKSNTKND
QPVVSSFIKCAQKLIWKRFRIGMMHDAQEFLRYFLEALHKSCLPKNLQTDQTFRKIHPIA
ASTTYIGQLFCGFFLSRIVCHNCQYTSNTYDPFMDVPLDIMGVSNLENALKLFTKIEYLK
GENRYMCPKCNQRSDASKQLLIEKLPPLLTIQLKRFSYVGHGSRKPNKAINFSDVLDLQP
YMSSKTYSESKVSSSKSESSYIYKLWAVVCHSGNTLSCGHYYTHAKSIDNKWYCFNDDYV
KPTRIENVLNENHKAYLLFYYRSDFNKYDLLKDSGVSIESLGKSQIITPLAPEISFINLQ
LKSNSKSSINGKNNNSKESSNSESNLNEFLDQLLTNKSKGERDLAQNQDQDPNLQFYQNQ
QNNNNIRLVLNPIINTDVNNEKLDSKISIISKNEQTEKIIKAKICNFKLRSLLLCDNWIT
RSKSRRNLATIFYLKKLKKLGLSMNYFIKSKSGNCSNGKVLISNINKSQIDTWEDLNLSN
DTITSLEQAQKSLLARSNIRSDYDKEYDKGKVKKPLRQAILASTSSNNNNEKNTNSKFQA
KKSAFMEKSNIKDLDTLSTSELFDIAFKNKGNLKNKNKRKNVRIR
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaattttaagtcaagaagctgagaagcggcaagattctcatcctgtgaccctt
caattgtcaaatcgtctagtcaatttcgtttctggaggatttttggccaacaaaacaggt
atagagtcttcttcttacgtttcagataattcccagatctcagataaaacacagaaacat
atggacaaattaaaagaaaaagaacaaattgaaaataatgttccattagcaaagccagaa
tactattatttccctccagaattactcactgatgcaagagattttcttgaaccaaaagaa
atctctcacttcagaccatatggtagaggattagctaatcctggttggaatacatgttat
tttaattctattttacaagcattaacttatgcaccttatctttcaattgattgcttaagg
aggaatcaccaaaagatttgtaaacatatgaaagaccatttggtttgtattatgtgtatg
tttgaagatcatgttaatattatgttggataatacatccaaatctaatacaaaaaatgac
caaccagtagtttctagttttatcaaatgtgctcaaaaattaatatggaaaagatttaga
attggaatgatgcatgatgcacaagaatttctaaggtatttcttagaagctttacataaa
tcttgtttacctaagaatttacaaactgatcaaacttttaggaaaatacatcctattgca
gcttcaacaacttatattggtcaactattttgtggattctttctttctaggattgtatgt
cataattgtcaatatacttccaatacatatgacccatttatggatgtaccacttgatatt
atgggggtatcgaatttagaaaatgctctcaaattatttactaaaattgaatatcttaaa
ggtgaaaatagatatatgtgtccaaaatgtaatcagagatctgatgcttcaaaacaactt
ctaattgagaaacttcctccactattaacaattcaacttaagagatttagttatgtagga
catggaagtagaaaacctaacaaagctatcaatttttcagatgttttggatttacaacca
tatatgtcttctaagacttattctgaatctaaagtatcttcatctaaatctgaatcctct
tatatttacaaattatgggctgtagtatgtcattctggtaatactttatcttgtggtcat
tattatacccatgctaagagtattgacaacaaatggtattgctttaatgatgattacgtt
aaaccaacaagaatagaaaatgtattaaatgagaatcataaggcttatttgttgttttac
tataggagtgattttaataaatatgacttacttaaggattctggtgtctccatagagtct
ttagggaaatctcagatcattactcctttagctcctgaaatatcatttataaatcttcaa
cttaaatcaaactcaaaatcctctataaatggtaaaaataataattctaaagaatcatca
aattctgaatcaaatttgaatgaatttttggatcaattattaacaaataagtctaaagga
gaaagagatttagcccaaaatcaagatcaagatccaaatttacaattttatcagaaccaa
caaaataataacaatattagactagttttgaatccaataataaatacggatgtaaataat
gaaaaattagattcaaagatttctataatatctaaaaatgagcaaacagaaaagattatt
aaggctaagatttgtaatttcaagcttagatccttattactatgcgataattggattact
agatccaaatcaagaaggaatttagcaaccattttttatcttaagaaattaaagaaactt
ggattatcaatgaactactttattaaatcaaaatcaggaaattgttcaaatggaaaagtt
ttgattagtaatattaacaagagtcaaatagacacttgggaagatcttaatttatctaat
gatactattacaagcttggaacaagctcaaaaatctcttcttgctcgttcaaatattaga
tcagattatgataaggaatatgataaaggtaaagttaaaaaacctctaagacaggctatt
ctagcttctacaagttccaataataataatgaaaagaatactaatagtaaattccaagct
aaaaaatcagcatttatggaaaagagcaatataaaagatttggataccttaagtactagt
gaactatttgatattgcttttaagaataaaggtaacttaaagaacaaaaataaaagaaaa
aatgttagaattagataa

DBGET integrated database retrieval system