KEGG   Cryptosporidium parvum: cgd8_4650Help
Entry
cgd8_4650         CDS       T00168                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cpv  Cryptosporidium parvum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpv00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cpv00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:cpv03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cpv03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cpv03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cpv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpv03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 128 aa AA seqDB search
MPPNVNKKRKRSAKGLKESEKENQSKLVGFKTSIVRPIVNPELEATDLKPVQSANDNEQL
LNTLHSFDLDHTFGPCSEISRSKRLERAKKFGIAIDLNLEKMINKHCGDVNSEMSVSIID
KLMKHYAD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaatgtaaataagaagagaaaaaggtcagccaaaggcttaaaagaaagtgaa
aaggaaaatcaatcaaaactagtaggattcaagactagtattgttagaccaatagtaaat
ccagaattggaagctacagatttaaagccagtacagagtgctaatgataatgaacaactt
ttaaatacattgcatagttttgacttggaccacacttttggcccatgcagtgaaatttcc
agatccaaaagacttgagagagccaaaaaatttggaatagctatagacttgaatttagaa
aagatgataaataaacactgtggagatgttaatagtgagatgtcagtttcaataatagat
aaattaatgaaacattatgctgattag

DBGET integrated database retrieval system