KEGG   Cryptosporidium parvum: cgd8_4650Help
Entry
cgd8_4650         CDS       T00168                                 

Definition
(RefSeq) hypothetical protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
cpv  Cryptosporidium parvum
Pathway
cpv00230  Purine metabolism
cpv00240  Pyrimidine metabolism
cpv01100  Metabolic pathways
cpv03030  DNA replication
cpv03410  Base excision repair
cpv03420  Nucleotide excision repair
cpv03430  Mismatch repair
cpv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cgd8_4650
   00240 Pyrimidine metabolism
    cgd8_4650
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    cgd8_4650
   03410 Base excision repair
    cgd8_4650
   03420 Nucleotide excision repair
    cgd8_4650
   03430 Mismatch repair
    cgd8_4650
   03440 Homologous recombination
    cgd8_4650
DNA replication proteins [BR:cpv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    cgd8_4650
DNA repair and recombination proteins [BR:cpv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      cgd8_4650
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     cgd8_4650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 3374449
NCBI-ProteinID: XP_627350
ApiDB_CryptoDB: cgd8_4650
UniProt: Q5CVB9
Position
8
AA seq 128 aa AA seqDB search
MPPNVNKKRKRSAKGLKESEKENQSKLVGFKTSIVRPIVNPELEATDLKPVQSANDNEQL
LNTLHSFDLDHTFGPCSEISRSKRLERAKKFGIAIDLNLEKMINKHCGDVNSEMSVSIID
KLMKHYAD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaatgtaaataagaagagaaaaaggtcagccaaaggcttaaaagaaagtgaa
aaggaaaatcaatcaaaactagtaggattcaagactagtattgttagaccaatagtaaat
ccagaattggaagctacagatttaaagccagtacagagtgctaatgataatgaacaactt
ttaaatacattgcatagttttgacttggaccacacttttggcccatgcagtgaaatttcc
agatccaaaagacttgagagagccaaaaaatttggaatagctatagacttgaatttagaa
aagatgataaataaacactgtggagatgttaatagtgagatgtcagtttcaataatagat
aaattaatgaaacattatgctgattag

DBGET integrated database retrieval system