KEGG   Cryptosporidium parvum: cgd8_4650Help
Entry
cgd8_4650         CDS       T00168                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cpv  Cryptosporidium parvum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    cgd8_4650
   00240 Pyrimidine metabolism
    cgd8_4650
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    cgd8_4650
   03410 Base excision repair
    cgd8_4650
   03420 Nucleotide excision repair
    cgd8_4650
   03430 Mismatch repair
    cgd8_4650
   03440 Homologous recombination
    cgd8_4650
DNA repair and recombination proteins [BR:cpv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      cgd8_4650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 128 aa AA seqDB search
MPPNVNKKRKRSAKGLKESEKENQSKLVGFKTSIVRPIVNPELEATDLKPVQSANDNEQL
LNTLHSFDLDHTFGPCSEISRSKRLERAKKFGIAIDLNLEKMINKHCGDVNSEMSVSIID
KLMKHYAD
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaatgtaaataagaagagaaaaaggtcagccaaaggcttaaaagaaagtgaa
aaggaaaatcaatcaaaactagtaggattcaagactagtattgttagaccaatagtaaat
ccagaattggaagctacagatttaaagccagtacagagtgctaatgataatgaacaactt
ttaaatacattgcatagttttgacttggaccacacttttggcccatgcagtgaaatttcc
agatccaaaagacttgagagagccaaaaaatttggaatagctatagacttgaatttagaa
aagatgataaataaacactgtggagatgttaatagtgagatgtcagtttcaataatagat
aaattaatgaaacattatgctgattag

DBGET integrated database retrieval system