KEGG   Cryptosporidium parvum: cgd8_750Help
Entry
cgd8_750          CDS       T00168                                 

Definition
cyclic nucleotide (cGMP)-dependent protein kinase with 3 cNMP binding domains and a Ser/Thr kinase domain
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cpv  Cryptosporidium parvum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ApiDB_CryptoDB: 
UniProt: 
Position
8
AA seq 965 aa AA seqDB search
MAFLTKLKTSKFSSGVKAAKETTYEELSKEENDEIEYPEEKMVVFRDRQKANIQSRIGGL
SKNMSNISNAGGGMEDDYEQNMVISHLKDREKTEEDIKTISKALAGNVVGASLNESEIAT
LVSSMHYYEYEVGEVVIEQGASGFYFFVISTGSFGVEINGNRVNTMSEGTAFGELALIHN
TPRSATILVIEKGGLWGLGRSTFRDTLRLISSRNYEENRAFIESLSIFSGLTDKQKSLLS
EALVREIFVKDQVIIREKEIGNVLYMIKSGIVGVFVEDKYIRSLNEGDAFGERSLMFDEP
RSATVIANATTECLTLNRGILTQILGNLGQVLSKNLIQQSLQNSPIFKQFTKNQMQILLD
KISIKTFQKDVILSTAETKALNMRAFVILEGEVQVSLPSNWLSRRASSLTSMVIDKSIGS
VNNYSLSDYINVNLGRGDYFGDDFVFHPKIPFVCKIEMKSETKIGVITSSMLSECFGDEN
VDVGLEINRKRDAIKSCFVFQYVSEQQLSLLVKSLRLVKFTSGEKIVVQGDKGTAFFILQ
SGEVAVYRNNKFIRYLGKNDYFGERALLYDELRSATIEAATPEVHLWTVDKEAFLKIVEP
PMRRYLDERIKLQETRVQMSDLKILQTIGKGTFGVVYMVENIKSGNKYALKKISKSRILA
LNMQAHVKLERSILALNDHPFIIKLVRTFKDSENIYLLTELIPGGELYDALQRIGLLTRY
QAQFYIGSIILALEYLHERSIVYRDLKPENILLDSQGYIKLIDFGCAKKIAGRSYTLAGT
PHYMAPEVILGKGYNLSCDAWAIGICLYEFLCGCLPFGNDAVDHLEIFKDILTSKLVFPR
HLNDVDTVNIIKRLLCRVPEVRMGCSATGYKEIKDNVFFKDFNFDRLLGRSYVAPLVRKY
RVFAKNTENENIVENITEVSQNEEALSPNTHNIKSKQKISFNASKNHSVSTRGNKMDEYD
WDIEF
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctaacaaagttaaaaacgagtaaattttcttctggtgtaaaagcggccaaa
gaaacaacatatgaagagttatcaaaggaggaaaatgatgaaattgaatatccagaagag
aagatggtggtctttagagatagacaaaaagcaaatattcagtcaagaattggaggctta
agcaagaatatgagtaatataagtaatgctggtggcggaatggaggatgattatgaacag
aatatggtaatatctcacttaaaggatagagaaaagacagaagaggacataaaaactatt
tccaaagcattggcaggaaacgtagtgggagcttcactgaatgaatctgaaattgctact
ttggtcagttccatgcattattacgaatatgaagtgggggaagtggtaattgagcaagga
gcatctggattttacttttttgtcatttcaacaggaagttttggggttgagattaatggt
aacagagtcaacacaatgtcagaaggaacagcttttggagaattagcgcttattcacaat
actccaagaagtgctaccattcttgttattgaaaaaggaggactttggggacttggaaga
tccacttttagagatacactgagacttatttcatctcgaaattatgaggaaaatagggca
ttcattgaaagcttatcaatattttcaggtcttactgacaaacaaaagagtctcttatct
gaagctttagttagagagatttttgttaaagatcaggtcattattagagaaaaagaaatt
ggtaatgtattatacatgattaagagtggtattgttggagtttttgttgaagataaatat
attcgttctttaaatgagggagacgcctttggagagagatctctaatgtttgacgaacca
aggtctgcaacagtaatagcaaatgcaacaactgaatgtttaactttgaatagaggaatt
cttacccagattttaggtaacttaggacaagttctgagcaaaaacttaattcaacaatct
ctacaaaattctccaatatttaagcaatttacaaaaaatcaaatgcaaatattacttgat
aagatttctattaagacttttcaaaaagacgttattttgtctactgcagagactaaagca
cttaatatgagagcctttgtcatcttggaaggagaggtgcaagtctctcttccatcaaat
tggctttctagaagggccagtagtttaacttctatggttatcgataaatctattggttct
gtcaataattactcactttctgattacattaatgttaacttaggaagaggagattatttt
ggggatgactttgtttttcatccaaaaattccatttgtatgcaagattgaaatgaaaagt
gaaactaaaattggagtaatcacatcttcaatgctttctgaatgctttggggatgagaat
gttgatgttggacttgaaattaacagaaaaagagatgcaatcaagtcgtgctttgtcttc
caatacgtttctgagcaacaactaagtcttttggtaaagtctttaaggcttgtaaagttt
actagcggtgaaaaaattgttgtacaaggtgacaaaggaactgcttttttcattttacag
tctggagaagtagctgtttatagaaataacaagtttattcgttatcttggaaaaaatgac
tactttggcgaaagagctctgctttatgatgaattaagatctgctactattgaggctgca
acccctgaggtgcatctatggactgtagacaaagaagcctttcttaaaattgttgaacct
ccaatgagacgatatcttgatgaaagaataaagctacaggaaaccagagtgcaaatgagt
gatttaaagattcttcaaacaattggtaaaggaacatttggagtcgtttatatggttgaa
aatattaaatcaggaaataaatatgcacttaagaaaatttccaagtcacgaattttggcg
ctcaatatgcaggcacatgtaaaattggaaaggtccattttggcgctcaatgaccatcca
tttattattaaacttgttagaacatttaaggattcagaaaatatatatttgttgacagaa
ttgattcctggaggagagctatatgatgcattacaaagaattggtttattaacacggtat
caagctcaattttatattggctcaattattctagctctcgagtatttacatgagagatct
attgtatatagagatttgaagcctgaaaatatattactagattctcagggatatattaaa
ttgattgattttggttgtgcaaaaaagattgctggtagaagttatactttggcaggtacc
ccacattacatggctccagaggttattcttggaaagggatataacttaagttgtgatgca
tgggctattggaatttgcttatatgagtttttatgtggttgtcttccatttggaaacgat
gctgttgaccatttggagatttttaaggatattttgacttcaaagttggtatttccaaga
catttgaatgatgttgatactgttaatataataaagagattattatgtagggttccagag
gttaggatgggatgttcagctactggctataaggaaatcaaggacaatgtattttttaag
gattttaattttgataggttgttaggcaggagttatgttgctccattagttaggaagtat
cgagtttttgcaaaaaatacagaaaatgagaatatagttgagaatattactgaagttagt
cagaatgaggaggctttgagtcctaatacccataatattaagtccaagcagaaaataagt
ttcaatgcttccaaaaatcactctgtaagtacaagaggaaacaagatggatgagtatgat
tgggatatagagttttaa

DBGET integrated database retrieval system