KEGG   Coccidioides posadasii: CPC735_000130Help
Entry
CPC735_000130     CDS       T01332                                 

Definition
tRNA pseudouridine synthase D family protein
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     CPC735_000130
Transfer RNA biogenesis [BR:cpw03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CPC735_000130
 Prokaryotic Type
    CPC735_000130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 764 aa AA seqDB search
MDEHPSGDESRRKRVKLSEADAAATASSAAQRATGGVGRLRAATSDDAQALKEAEVGITE
FVSPDLPGFSGILKKRYTDFLVNEILPSGEVLHLQDINLPASLKASSQNPSVQKSGPEKE
TAVRENGEPQSADNQPGDRATDAAAGSAETPAVEGGRANPEIPDEDRKILEQHLGPDVAQ
KVLKLYARALAKPNLRAGDLGRVKSDSVPDKETRTIIHQALRRIFGGRIESSTESDNSLL
ISSVPVRRLKAQMKGGVADNRRGKLGWSEVGGEYLHFTIYKENKDTMEVINFLARQMKLG
VRGFNFAGTKDRRGVTVQRACVFRVDAGRLANMNRILRNAAVGDFEYQKQGLELGELGGN
EFVITLRDCDFPVTLGEDPIAAASDLVSTAMENLREKGYFNYYGLQRFGTFATRTDTIGL
KMLQSDFKGACECILHYTPACLDAGQGKPREGDDILLSSDDISRAEAIHIFESTGQAGPA
LAKMPRKFTAESNIIKHLGRKQNDYMGALQTIPRNLRLMYVHAYQSLVWNFSVGERWRLY
GDKVVEGDLVLVNEFKDRDSDPTIAEEVDADGEAIVLPDTADSSVSVDSVFERARALTSE
EAASGKYTIFDIVLPLPGYDIIYPPNKMTEFYKTFMGSERGGKLDPFDMRRKWKETSLSG
SYRKILSRPGPDYSLDVRMYTDDNEQFIKTDLERIRQNAHNFPAKSTNENAKVGNEDMDD
KQKEKLAVVVKFQLGASQYATMALRELMKTGGAKVYKPEYMGGR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcacccgtctggcgatgaatcccgtcggaagcgcgtgaagctttcggaagcc
gacgcagctgcaacggcgtcttcggctgcacagcgggcaactggtggagttggaagactt
cgagcagcgacgtcggacgatgcgcaggcattgaaagaggcggaggtagggattacggag
tttgtaagcccagatctacctgggttctcgggcattcttaaaaaacgatataccgatttt
ctggtcaatgagatcctcccatccggtgaagtgctccacttgcaggacatcaatcttccg
gcgtctttaaaagcaagctcgcaaaatccttcggtgcagaagagtgggccagagaaagaa
actgcagtgcgggagaatggagaaccccaatcagcggacaaccagccgggtgacagagca
actgatgcggctgcaggctcagcagagacacccgctgtagagggtggacgggcaaacccc
gaaatccccgatgaagaccgaaagatcctagaacagcatcttgggccagatgtagcgcaa
aaggtcctgaaactttacgctcgtgcacttgccaaaccgaatctcagagctggagacttg
ggccgtgtgaaatcagactcagtaccggacaaagagacgagaacaatcatccaccaggct
cttcgacgtatatttgggggccggatagaatcttcaaccgaaagcgataactcgttgcta
atctcctctgtccctgttcgaagactaaaagcccaaatgaaaggtggtgttgcggacaat
cggagagggaaactgggctggagtgaagtcggaggcgagtatctccatttcactatctac
aaggagaacaaagatacgatggaggtgatcaattttctagctcgccagatgaaactaggc
gtgagaggttttaattttgcgggcacaaaggaccgacgtggcgtgacggttcaacgggcg
tgtgtcttccgcgtcgatgccggtagattggcaaatatgaatcgtatcctgcgtaatgct
gccgtcggagattttgaatatcaaaaacagggattagaactaggcgagcttggtggaaac
gagttcgtcataacccttcgagattgcgatttcccagtcactcttggagaggacccaatc
gcagccgcctcagaccttgtttctaccgcaatggaaaatctccgcgaaaaaggttacttc
aactactatggactacagcggtttggtacttttgcgacccggacggacacgatcggactc
aagatgctacagtcagacttcaagggagcgtgtgaatgtattctacattatactccggct
tgcttggacgcaggacaaggaaagccacgcgaaggagatgatattcttctaagctctgac
gatatctcccgcgcagaagcaatccacatcttcgaatcaaccgggcaagccggtccagcc
ttagcgaaaatgccgagaaagttcacggccgagtccaacatcatcaagcaccttgggaga
aaacagaacgattacatgggcgccttacaaacgattccacggaacctgcggctgatgtac
gtgcacgcctatcaatctctcgtttggaacttctccgttggcgaacgatggcgtctctac
ggcgacaaggtcgtcgagggggatttagtcctagtcaatgaatttaaagatcgtgattcc
gatcccaccattgctgaggaagtcgacgccgacggcgaagccatcgtcttaccggacact
gccgacagctctgtttctgtagatagcgtgttcgagcgtgcacgagcactaacaagcgag
gaagctgccagcgggaaatacaccatcttcgatatcgttttaccacttcccggatacgac
atcatctacccgcccaacaaaatgacagaattctacaagaccttcatgggcagtgagcgg
ggcggaaagctggatcccttcgacatgcgcaggaaatggaaagaaacgagtcttagtggg
agctataggaagattcttagtcgaccaggccccgactattcgctcgatgtgaggatgtac
acggacgacaatgaacagttcatcaagactgacctagagcgaattcgtcaaaatgcccac
aactttccagcgaagtcaaccaatgagaacgccaaagttggaaatgaggatatggacgac
aaacagaaagaaaagctggctgtggtagtcaaattccagcttggggcgagccaatatgct
accatggcacttagagagctgatgaaaactgggggagctaaggtttacaagccagaatat
atgggtgggaggtga

DBGET integrated database retrieval system