KEGG   Coccidioides posadasii: CPC735_000210Help
Entry
CPC735_000210     CDS       T01332                                 

Definition
Protein kinase lkh1, putative
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CPC735_000210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 671 aa AA seqDB search
MSTPSTATATHPANHPHYRYPHQSSFHSNVTAYPATTSSSSSSAAVAVAATRVTNYNYPS
QPAAAALPPPSSSAPKPSQAQPAMAAYQTSTTLPTAQSRRRKPNWNEFYKNGVPKEIIVI
DDDEDDPQNTSAANSVYTSSTVKPSSMASYGNGVAAQPASKKRRTGVETTYDLSYHDPPS
YSVAVQQYGEGSSGTSLSTDRTASLHTTAPTSLGSHGSAPTNNVYYEDAAIGQKRKRVVT
RKAARDEQKRRELEIAGYSTYIPPPKPPIKAKDVYVPVIRDPNFTKHSKVDDDDGHYIVT
PDTNLTDRYSIIKLLGQGTFGKVVEAFDRQKKTRCAIKIIRSVQKYRDASRIELRVLSTL
ASNDETNRNKCIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQSFARQLF
TSVAFLHDVNLIHTDLKPENILLVNNAYQTFTYNRTIPSSSHTTNRTARQRRVLLDSEIR
LIDFGSATFDEEYHSSVVSTRHYRAPEIILNLGWTFPCDIWSIGCILVEFFTGDALFQTH
DNLEHLAMMESVVGSRIDTKLVRQVMQGRNGSNPAAKYFNRTRLDYPNQDTPRSSRKYVK
AMKQLQDFIPANNSFNKQFLDLLRRIFVYDPFARIKASEALKHPWFNESIIDDGTEAVRI
GQMQRERANRA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccctccactgccactgccacccacccggcgaaccatccgcactaccgatat
cctcaccagtcctccttccactccaacgttaccgcgtaccctgcgaccacctcctcctca
tcctcctccgccgccgtggccgtggccgcaacccgcgtcaccaactacaactatccctcc
cagcctgccgccgccgccctccctcctccctcgtcctccgcccccaaaccatctcaagcc
cagccggccatggcggcatatcagacgtccaccaccctcccaaccgcccaaagtcgtcgg
agaaagccgaattggaacgagttctacaaaaatggcgtccccaaggaaattatcgtcatt
gacgatgacgaggatgatccacaaaatacatctgcggccaactctgtttacacatcatcc
accgtgaagccttcctctatggcctcctacggcaatggcgtcgctgcacagcctgcgagc
aagaagcgacgcaccggtgtcgaaacgacttacgacctttcgtatcatgatcctccaagc
tactccgtggccgtccaacagtatggtgaaggctcttcggggacctcactctctacggac
cgtactgcctctcttcacaccactgcaccgacgtcgttgggatcccacgggagcgccccg
accaataatgtgtactacgaagatgccgcgatcggccagaagcgcaaacgggtcgtaaca
cgcaaggcagcccgcgatgagcagaaacgtcgagagttggaaatcgctggatacagcaca
tatattccaccccctaagccgcccatcaaggcgaaggatgtttatgttcctgtgatccgc
gaccccaactttacaaaacattccaaggttgacgacgatgatggccattacatcgtcact
cctgatacaaatttgactgatcgatattcgatcatcaagctgctgggtcaaggaacattt
ggaaaagtcgtcgaggcttttgataggcagaagaaaacccgttgcgctatcaagatcatt
cgatctgtccaaaagtatcgtgatgcctctcgtattgaacttagggtcctatcgaccctg
gcatccaacgacgaaaccaaccgcaacaagtgcattcatcttcgggactgttttgacttt
cgaaaccatatctgcatcgtgactgatctgctaggacaaagtgtgtttgatttcctcaaa
ggaaatggctttgtacctttcccaagcagtcagatccagagttttgctcgccagttgttc
acgagtgttgcttttctccatgatgtcaacctgatccataccgatttgaagcctgaaaat
attctcttggtgaacaacgcctatcaaacatttacgtacaatcgcacaattccctcttca
tcccataccaccaaccgtactgcccgtcagcgacgggtgctgctagacagcgagatccgg
ttaatagatttcggctctgccacctttgatgaggagtatcactcctccgtcgtctcaact
cgccactaccgtgctccagaaatcatcctcaaccttggatggacgttcccctgcgatatc
tggagcatcggctgtatcctagtcgaattcttcactggagatgctctcttccagacccac
gacaacctcgagcatcttgcaatgatggagagcgtcgtgggaagccggatcgataccaag
ctggtgagacaagtaatgcaaggacgtaatggatcgaatcccgctgccaagtatttcaac
cggactaggctggattatccgaaccaggatactcctcgatcgtctcgcaaatatgtaaag
gctatgaagcaattgcaggacttcattcctgccaataattccttcaataagcagttcctt
gaccttctccgccggatattcgtgtatgacccgttcgcgcgaatcaaagccagtgaggcc
cttaagcacccctggtttaatgagtccatcatagacgatggcaccgaggccgttcgcatt
ggccaaatgcagcgagagagagcaaatcgcgcatag

DBGET integrated database retrieval system