KEGG   Coccidioides posadasii: CPC735_001120Help
Entry
CPC735_001120     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cpw  Coccidioides posadasii
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CPC735_001120
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPC735_001120
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CPC735_001120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 387 aa AA seqDB search
MVALKALAFGLFLSRVLAVPTPVESSTSPSDTPPTASPSTPEAQAQLEQLSSIAYNVSRS
NLETGSQTKRSGGCSLSNLRVRREWSTFTARQRKSYIDAVLCLQSLPARTPSSIAAGAKT
RYDDFVAVHIQQTLTIHYTGHIVRYWDWPLSAVIGLENHPLFDGSDTSMSGNGEPIPNKG
DIFLHLGDLPSIRLPSGTGGGCVTSGPFKNFKVNLGPAALVLPGDRTEAVANPLDYNPRC
LKRDLTDAIVRKFANATAVVDLILRRKTIESFQMNMQGIPGSGSIGVHGGGHYAMGGDPG
RDVFVSPGDPAFFFHHAMIDRVWWIWQNLDLKNRQNAIHGTGTFLNDPPSPDTTLDTMVD
LGYAGGPTLPMRDLMSTINGPFCYVYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggttgccctgaaagccttagccttcgggcttttcctctctcgggtgcttgctgtgcca
acacctgtggaaagcagtacctcgccctcagatactccgcctactgcgtctccctccacc
ccagaggcccaggcccaactcgaacagctgtcgtctatcgcgtacaatgtgagcaggtcg
aatcttgaaaccggctcgcagacgaaacgcagcgggggctgcagcttgtcaaatctcaga
gtgcgtcgtgaatggtccacatttacggcaaggcagaggaagagttatatcgatgctgtc
ctttgtctgcagagcttgcccgccaggacgccatccagcattgccgcgggagcaaagact
cgctatgacgatttcgtcgctgtccatatccagcagaccttgaccatccactataccggc
cacatcgttaggtactgggattggccgctttcagcagtaattggcctggaaaaccatccc
cttttcgacggcagcgacacgtccatgtctggtaatggggagccgatccccaacaagggt
gatatttttcttcatctcggagatctaccctcaatccggctgccttcgggcactggtggc
ggatgtgtcactagcggtccattcaagaacttcaaagtgaaccttggccccgctgcgctc
gtcctcccaggcgacagaaccgaagcggttgctaacccactggactacaacccccgctgc
ttgaaacgtgacctcacagatgccatagttcgaaagtttgccaacgctaccgctgttgtg
gatttgatcctccgcaggaaaactattgaaagtttccagatgaacatgcaaggtattcct
gggagcggttccatcggtgttcatggcggcggtcactacgccatgggtggcgatccgggc
cgcgatgtctttgtctcacccggtgatccagcctttttctttcaccatgcgatgatagat
cgcgtgtggtggatctggcagaatttggatctgaagaatcgtcagaatgcgatccacggg
acaggcacattcttgaacgatcccccgtcccctgacacgacactcgacacgatggttgat
ctggggtatgcgggtggcccgacgcttccaatgcgcgacctgatgagtacgataaatggg
cccttctgctatgtgtatttgtaa

DBGET integrated database retrieval system