KEGG   Coccidioides posadasii: CPC735_001160Help
Entry
CPC735_001160     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CPC735_001160
Translation factors [BR:cpw03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CPC735_001160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MAPSKWDDEEESTPPSTPPPFVARRKFDDEEDSDEVLDSWDAAEDSEVEREKEAKAAAAK
AKAEAEAAAQKKSKAQRIAEHKARRALDEEESSEEEDAAEQRARLRRTEKESDLKHAQDL
IGDIDLNRNRSAPKATVISDPNDPTKSIDISAMPLFKPGTKAQFTTLTETLAPLLAAQSK
KPQYSIWVQEFTKRLVKELPSSEIKKVASALTAASNEKLKEEKAADKGGKKSKAAKTKTS
LVTTHSNRADLTAYDGDELDDDDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggacgatgaagaggagagcacacctccttccaccccgccgcca
ttcgtggcaagacgcaagtttgacgatgaggaagatagtgacgaggttctagattcctgg
gacgccgccgaagattcggaagtcgagcgagagaaggaagcaaaagcagctgcagctaaa
gccaaggctgaagctgaagccgccgcgcagaagaaatcaaaagcgcaaagaatagcagaa
cataaagcccggcgcgcccttgacgaggaagaatcgagcgaggaggaagatgctgcggaa
cagcgggcgcggctgagacggacggagaaggagtccgatctcaagcacgcgcaggatctt
atcggcgatatcgatctcaaccggaaccggtcagcgcccaaggcgaccgtcatttctgac
ccgaatgaccctaccaaatctatcgatatctctgccatgccgctcttcaagccgggaacc
aaggcgcagttcaccactctcacagagaccctcgctcctctactagccgcccaatccaag
aagccgcaatactctatctgggtccaagagtttacgaagcggcttgtaaaggagctcccc
agttcggaaatcaagaaggtggcaagcgctttgaccgccgctagcaacgagaaactcaaa
gaggaaaaggccgctgacaagggcgggaagaagagcaaggcagccaagaccaagacaagt
ctcgtcaccactcactcgaaccgcgcggatctcacagcgtacgatggcgatgagctggac
gatgatgactttatgtga

DBGET integrated database retrieval system