KEGG   Coccidioides posadasii: CPC735_002410Help
Entry
CPC735_002410     CDS       T01332                                 

Definition
Longevity-assurance family protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPC735_002410
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CPC735_002410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 449 aa AA seqDB search
MAKPARSHSNSVTEVQACVSSPEGRGPIRKDASLRERLLSNQIGISLTILTMIFAVHNLY
PSLRPYTSPFLTLPHYRSTKGIYVQGWDDLYFIIGSMVAFTAIRAIAIDWILMPIAQQLG
LKLKASLRFAEQGWLLVYYIVFWSYGLYIWMHSKYWMDFREIWTDWPSREIPGYFKLYCL
LQLSFWLQQIFVINIEERRKDHYQMLTHHIVTSTLLGSAYVYSFYNVANVVLCIMDIVDF
LLPAAKMLKYMGYERICTIAFGVFLATWFIARHVIYMMLWWSIYQNVPDAMSFGCYLGAT
GQKLIDVSPDSWGSLIYPFRDIDGPICMSFRIKWAFLTLLLILQMLSLIWFGMILRVAVH
VLRTGSSAEDTRSDDEGEESTEAVRPVRRGSPRRQEDYEENGWSKSVAVNGSAQNHHPVR
IRTARGRVTLSDQNERKALLGRIGCDKPS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccggcccgtagccattccaactctgttacagaggtccaggcctgcgtttcg
tcaccagaagggagagggcctatcaggaaagatgccagtcttcgagaacggctgctcagc
aaccaaatcggaatctcccttaccattcttacgatgatcttcgcggttcataacttatac
ccttcgcttagaccatacacgtctcctttcttaactttgccacattaccgatcgacaaaa
ggaatatacgtccagggatgggacgacttgtacttcatcatcggttccatggtcgccttt
acagcaatccgagccatcgcaattgactggatccttatgcccatcgcacaacaacttggg
ctaaaattgaaggcatcgttgagattcgccgaacaaggctggctactggtgtattacatt
gtcttctggtcctatggtttgtatatttggatgcattcaaagtactggatggatttccga
gaaatttggacggactggccgtcgagagagataccaggctatttcaagctgtattgcctg
ttgcagttgtcattttggttgcaacaaattttcgtcatcaacattgaggaaagaagaaaa
gaccattatcagatgttgacgcatcatatcgtcacaagcacccttctcggatcagcttat
gtttacagcttctataacgtggccaacgttgttctatgtattatggatattgtagatttc
ctcctcccggctgcgaagatgctaaaatatatgggttacgagcgcatttgcaccattgca
ttcggggtcttcctagccacatggttcattgcccgccatgtgatttacatgatgttatgg
tggtccatttaccaaaatgttccagatgcaatgtcatttggatgttatctgggcgcaacc
ggccagaagcttattgacgtatctcccgattcctggggctcactcatatatccgtttcgg
gatatcgatggacctatttgcatgagtttccgcatcaaatgggcctttctcactctgctc
ctaattcttcagatgctctctcttatctggttcggcatgatccttcgtgtggcagtgcat
gtgcttcggacaggctcatcagcggaggatacccgcagcgacgatgagggcgaagaatca
actgaggcagtccgccctgttcgccgaggcagccctagaagacaggaagattatgaagag
aatggatggagtaaatctgttgcggtcaacggttccgcccagaatcatcacccggtgcga
atcagaacagctcgcggccgcgttacactcagcgatcagaacgaacgaaaggctttactc
ggcagaatcgggtgcgacaagccttcttaa

DBGET integrated database retrieval system