KEGG   Coccidioides posadasii: CPC735_002890Help
Entry
CPC735_002890     CDS       T01332                                 

Definition
Asparagine synthetase 2, putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cpw  Coccidioides posadasii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpw00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 577 aa AA seqDB search
MCGIFACHCHPNVQKFKPTALRMAKAEYGESVRHRGPDWSGNFVSNNTILAHERLSIVGV
ESGAQPLVNDDETLALAVNGEIYNHRILRKGLKTQYKFKTHSDCEVIIPLYMEHDIDAPK
FLDGMFSWVLFDKKQNRVIAARDPIGITSFYQGWSSQTPGAVYFASELKSLHPVCDRIIS
FPPGHVYDSKTDTMTRYFQPKWWDPTNVPSTPIDYKLIRESLVRSVRKRLMAEVPYGVLL
SGGLDSSLVASIAQRETQRMMVAQNGTVTNGESGAGLVGIDDSNELSTVTSFPQLHSFSI
GLPGAPDTKAALEVANFLGTKHYAFTFTVDDGLNALSDVIYHLETYDVTTIRASTPMYLL
SRKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPDKKAFHEETVRRVKNLHLADCLRANKST
SAWGLEARVPFLDKQFLEVSMGVDPQEKMITKERIEKYILRKAFDTSDEPETKPFLPDNI
LWRQKEQFSDGVGYSWIDALKDNAELQVTDEMMKNPKPEWGDDIPDTKEAYWYRMMFDEH
FPPCCASTVMRWTPTWSKQTDPSGRAISTHVAKYDHA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcgtgtcactgtcaccctaatgtacagaaattcaagccgacggct
ttacgcatggcgaaagcagaatacggggaaagcgtccggcatcgtggtcctgattggagt
ggtaactttgtttccaacaacacaatccttgcacacgagcgattgagcatcgtcggtgtc
gaatctggcgctcagcccctcgttaacgatgacgagacattggcactcgctgtcaatgga
gaaatttataatcacagaatcctgaggaagggattgaagacccaatataaattcaagaca
cattcggactgcgaagttatcattccattgtatatggaacatgatatcgatgctccgaag
ttcctcgatggcatgttctcgtgggtgctttttgacaaaaaacagaaccgcgttattgct
gccagagatcccattggtatcaccagcttctaccaaggatggtcttcccagacacctggt
gctgtctatttcgcctctgaattaaagtcacttcatccggtctgcgacaggatcatctcc
ttccctcccggccatgtgtatgactccaagacggacaccatgactcgttacttccagccg
aaatggtgggatccaaccaatgttccgtcgacccccatagattacaaattgatccgcgaa
tctctggtgcgatctgttcgtaagcgactgatggcagaggttccctatggtgtcctgctc
tctggtggtttggactccagcctggtcgcctcgattgcgcagcgcgaaacccagcggatg
atggtggcgcagaacggcacggtcaccaatggagaatcgggcgcgggcttggttggaatc
gacgatagcaacgagctgtcgactgtgacttccttcccccaattgcattcgttctccatt
ggtcttccgggagccccagataccaaggctgctcttgaggtcgctaactttcttggaaca
aagcattacgctttcacattcacagtcgacgacgggcttaacgcactctcagacgttatc
tatcacttggaaacttatgatgtgacaactatccgtgcttctacacccatgtatctgctg
agcagaaagatcaaggctatgggcgttaagatggtgctcagcggtgaaggtagcgatgaa
atttttggcggatatctttatttccacgcggccccggataagaaagctttccacgaggag
acggttagacgagttaagaaccttcacttggctgactgcttgagagcaaacaagtcaact
tcagcatggggtcttgaggcccgtgtgccgttcttggataagcaattcctggaggtctcc
atgggtgttgatccgcaggaaaagatgatcaccaaggaaagaatcgagaagtacatcttg
aggaaagccttcgacacgtctgatgagccagaaaccaagccgttcctgccggataacatt
ctgtggcgccagaaagaacaattcagcgatggtgtcggctattcctggattgatgctcta
aaggacaacgctgagcttcaagttacggatgagatgatgaagaaccccaagccagagtgg
ggcgatgatatccctgatacaaaggaggcgtactggtaccgaatgatgttcgatgaacac
ttccctccgtgctgcgcgtccactgtcatgcgctggacacccacatggtcgaagcaaacg
gacccaagtggacgtgccatctcgacccacgttgcgaaatacgaccacgcatag

DBGET integrated database retrieval system