KEGG   Coccidioides posadasii: CPC735_004500Help
Entry
CPC735_004500     CDS       T01332                                 

Definition
C-14 sterol reductase, putative (EC:1.3.1.70)
Orthology
K00222  
delta14-sterol reductase [EC:1.3.1.70]
Organism
cpw  Coccidioides posadasii
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:cpw00100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MASKGGKVVSQAQHHRGYEFGGPIGSFVLTFGLPVLVYSFAFFCNDISGCPAPSLLHPST
LSLDKLKTEIGWPESGIKGLYDGHVTLYVLGYYLLSLFLQIFLPGTETQGEVLACGGRLK
YKFNAFNSAVLILLGCGAGTYIYGVDFPLWTFLWENYIQVLTANLLISSILAIFVYLYSF
TVPAPGTPNPMLRELAPGGQTRSALYNFFIGRELNPRVKLPIPFVKDTSRTIDIKVFCEL
RPGLLGWGLLNLSNVAHQYKVNGSLTSSILLVTAFQGFYVLDGLYMEPAICTTMDIIMDG
FGFMLAFGDLVWVPFTYSIHTRYLAIYPFELGIYGAALVIGVQSLGYYIFRSTNNQKDRF
RKNPNDPRVKHLQYIQTSRGSKLITSGWWGAARHINYLGDWIMSWTTCLPTGIAGYAMVE
RLNPLTGTSEVRAVQTEESRGWGMVFTYFYIVYFGILLVHRERRDEEKCRNKYGADWAKY
TSKVKSRIIPGIY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaagggcgggaaggtcgtttcccaggctcaacatcatcgaggatacgaattc
ggggggccaatcggatcatttgttttgacattcggcttgccggtgctggtttacagtttt
gcgttcttttgcaatgatatctcgggatgtcctgcaccgtcactcctccatccgtccacc
ttgtcccttgacaagctgaagacggaaattggttggccggagagtggaatcaagggctta
tacgatggccatgtcaccctttatgtgctgggttattatcttctcagtcttttcttgcag
atatttcttcccggcactgagacccagggagaagttttggcctgtggaggtcgactgaaa
tataaattcaatgcatttaactccgctgttttgatccttcttgggtgcggtgccgggaca
tatatttatggggtcgacttccccttgtggacatttctctgggagaactatatccaggtt
ctgactgcaaacctcttgatctcttctatccttgctatttttgtttacctctatagtttc
actgtcccagcaccaggtacaccaaatcctatgcttcgagagttagctcctggcgggcaa
acgcgcagtgccttgtataacttcttcattggacgcgaactgaaccccagagtcaaactc
cctattcccttcgtgaaggacacctctagaacaatcgatatcaaggttttttgcgaattg
cgaccgggattgttgggctgggggcttctgaacctgtcgaatgtggcacaccagtataaa
gttaacggaagcctcacgtcgtcaatcctcttggtgaccgcgtttcagggcttctacgtc
ctcgatggcctatacatggaaccggcgatctgcaccactatggacattatcatggacgga
tttggttttatgctggctttcggtgaccttgtgtgggtcccgttcacatactcaattcac
accagatacctggccatataccccttcgagctgggtatctatggggctgctcttgtgatt
ggggttcaatctcttgggtactatatcttccgtagcaccaataaccaaaaggaccgtttc
cgcaagaatccaaacgacccgagagtgaagcatcttcaatatatccagacttctcggggc
tcgaagctgattacgtccggatggtggggtgccgctcgtcacataaattatttgggcgac
tggatcatgtcatggacaacgtgcctaccgactggtatcgcaggttacgccatggttgag
agactcaatcctctgacgggaaccagtgaggtacgtgcggtgcaaacagaagagtctcgc
ggttgggggatggtgtttacttatttctacattgtgtattttggaatcctgcttgtccat
cgcgaaagacgagacgaggagaagtgcagaaacaaatatggtgcagactgggcgaagtat
acctcgaaagtgaagagcaggatcattccaggtatctattag

DBGET integrated database retrieval system