KEGG   Coccidioides posadasii: CPC735_004680Help
Entry
CPC735_004680     CDS       T01332                                 

Definition
kinase domain containing protein (EC:2.7.1.-)
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cpw  Coccidioides posadasii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cpw04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 493 aa AA seqDB search
MTSPAPLLKIPTPGNRKPPKLTVGIPPSPNARPVNQVGTTSQSDPQAQHLPSRQLPPELR
IATPMGSRGMIQQEDTSYHNGRPIPQPYSNSSNDLSAHSRSGSFTMHDGKNSGPASATSS
SFSTLSFAMGMRDPLGGAGDPSSAISSVYSDRGGGLPMERENSMNGVLPDLDKLSQELGR
PLDVEDLDDEKWAAASEQRKIIELDSLGEGAGGAVTRCILKGGKTVFALKVITTDPNPDV
KKQIFRELNFNKDCASEHICRYYGAFMDRSSSTISIAMEFCEGGSLDSVYKEVKKLGGRT
GEKVLGKVAEGVLNGLTYLHGRKIIHRDIKPSNILLCRTGQVKLCDFGVSGEFGTKGDAN
TFIGTSYYMAPERITGQSYTITSDVWSLGVTLLEVAQHRFPFPADGTVMQPRAGLIDLLT
YIVRQPIPKLKDEPENGIYWSDNFKYFIECCLEKEPPRRATPWRMLEHPWMLEMKNKKVN
MAHFLKQVWDWKE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccccgctcctctcctaaagatccccacgccgggtaaccgtaaaccaccgaag
ctcacagttggaatccccccttcgcccaacgctcgacccgtcaaccaggttggcactacc
tcgcagagtgacccacaagcacagcatctcccttcgcgccaactgccaccggagttgagg
atcgcaaccccgatgggcagcaggggaatgatacaacaggaagacacctcatatcacaat
ggtcggccgataccacagccatacagtaattcatcgaacgacctctcagcccactcgaga
tcgggcagcttcacaatgcatgatggcaagaacagtggccctgcatccgctacgtcctcg
tcattttcaaccctctcttttgccatgggcatgagggatcctctcgggggcgccggggat
ccatcgtccgctatcagctcagtgtactccgaccgtggtggcgggctacctatggaaaga
gaaaatagtatgaatggcgttctacccgacctggataagttgagccaagagttgggtagg
cccttggacgtcgaggacctcgatgatgagaaatgggccgctgcaagcgaacaaaggaaa
atcattgagcttgacagtcttggtgaaggcgctggtggagcggttactcgatgcatactg
aaaggtggaaagactgtttttgctttgaaggtcattacgaccgaccctaatcctgacgtg
aagaagcaaatattccgagaactgaatttcaataaagactgcgcttcagagcatatctgt
cggtactacggtgcgtttatggatagatcgtcaagtacgatttcaatagcgatggaattc
tgtgaaggcggcagcctcgatagcgtttacaaggaagtcaagaaacttggtggccgaaca
ggggagaaagtgcttggaaaagtcgcggaaggtgtactaaacggtttaacctatttgcat
gggcgcaaaattatccacagagatatcaaaccctcgaatatcctgctttgtcgaacgggt
caagtcaagctctgtgatttcggcgtcagcggcgaattcggaaccaaaggcgacgcaaat
actttcattggcacatcctattacatggctcctgagcggatcaccggtcaatcatatact
ataacttctgatgtttggtctcttggagtgactcttctcgaggttgcccagcatcggttt
cctttcccggcagacggaactgtgatgcagccaagagcaggcctgatcgacctcttgaca
tatattgtcaggcagcccattcccaagctgaaagatgagccagagaatgggatatattgg
agtgataattttaaatacttcattgagtgctgcttggagaaagaaccccctcggagagca
acgccgtggcggatgttggagcatccgtggatgcttgaaatgaaaaataagaaggttaat
atggcgcatttcctgaagcaggtttgggattggaaagagtag

DBGET integrated database retrieval system