KEGG   Coccidioides posadasii: CPC735_008880Help
Entry
CPC735_008880     CDS       T01332                                 

Definition
Histidine biosynthesis trifunctional protein, putative (EC:3.5.4.19)
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
cpw  Coccidioides posadasii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpw01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cpw00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 867 aa AA seqDB search
MSLPFLISVDADSISSPSPSGLTLKQVSYFGCVLLKSPSLERALSFVNANFTTFEICVDA
TAIESVGDVVDILNAGASNVFVTLGQLTSLSKEQSVPSSRLVVSISSADEVAQLKTWILE
DKERREICVHSAGSSPIDAILSELDDNSLVRTVYRSSIGETTQTNFLLNEQERVISIIPS
TSLTVDDEGNSAVKLLVTGAIPDNNTGLYATIVTDERGVALGLVWSSEKSISEALKTGTG
VYQSRKRGLWYKGQSSGDIQELVRVGLDCDSDCLIFVVKQKGRGFCHLGTASCFGSYTGL
SRLQKTLQARRQDAPPGSYTSRLFNDAKLLDAKIMEEAEELCKASTKEETAFEAADLIYF
ALTKCISAGVSLEDVERNLDLKSMKVKRRKGDAKPDWAAKVGLAPPTGIQKTAGSVETDK
PVDQRIRMKRYNTASASQKDIKDALQRPSQKSNEAIVGLVKPIIQDVRENGDAAVLKYTH
KFERATSLTSPVLRAPFSEDLMKLTPETKEAIDISFENIRRFHAAQKEDKALQVETMPGV
VCSRFVRPIGRVGLYVPGGTAVLPSTALMLGVPAMVAGCKKIVLASPPRSDGSISPEIVY
IAQKVGAESIVLAGGAQAVAAMAYGTESVTKVDKILGPGNQFVTAAKMLVSNDTSAGVSI
DMPAGPSEVLVIADKHANPAFVASDLLSQAEHGVDSQVILIAVDLNDAELAAIDDELHRQ
ASELPRVDIVRGSIEHSVTFVVRDIEEALALSNEYAPEHLILQIRDAANVVSMVENAGSV
FIGEWTPESVGDYSAGVNHSLPTYGYAKQYSGVNLASFVKHITSSNLTAEGLRNVSQAVM
QLASVEGLDAHRRAVSIRVDWMKQNKG
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaccattccttatctccgtcgatgcggactcgatatcctctccctctcccagt
ggcctcaccctaaaacaagtttcatatttcggctgcgtgcttctcaagtcacctagcttg
gaacgggctctctcgtttgtcaacgcgaatttcaccactttcgagatatgcgtcgacgct
actgctattgagtctgtgggagatgttgtggacattctcaatgccggagcatcgaatgtg
tttgtgacgctgggacaattgacatcattgtcgaaagaacaatccgtcccctcgtctcga
ttggtcgtttcaatctcatccgcagacgaggtcgcccaactgaaaacttggattttagag
gataaggagagacgcgaaatatgtgttcacagcgcaggatcctcccccattgacgctatt
ctatccgaacttgatgacaattccttggtaagaaccgtataccgctcctcgatcggcgag
acgacacagacaaacttcctcctgaacgaacaggaaagggttattagcataatcccgtct
acatcattaacggttgacgatgaagggaactctgctgtcaagctgctggttaccggtgct
atcccggataacaacactggtctctatgctacgatagtcacggatgagcgcggagtggcg
ttggggcttgtttggagtagcgagaagagtatttcagaggcattgaaaactggaacagga
gtgtaccaaagccggaagcgtggtttatggtataaaggccaatccagcggggatatacag
gaattggtcagagtcgggcttgactgcgacagtgattgcttgattttcgtcgtcaagcag
aaaggcagaggattttgtcatttgggaactgccagttgctttggctcctacacggggctt
tctcgtctccaaaaaacattacaagcacggaggcaggacgccccgccgggatcgtataca
tcgcggctcttcaacgacgcaaaactattggacgcaaagatcatggaagaagccgaagaa
ttgtgcaaagcatcgacaaaggaagaaactgcttttgaagccgctgatcttatttacttt
gctttaacaaagtgcatctcagctggcgtaagcctagaagatgttgaaaggaatcttgat
ttgaagagcatgaaggtgaagcgaagaaaaggcgacgcgaagccagactgggctgctaag
gttggccttgctcctcccacggggattcagaagacggctggatcggtcgagacggacaaa
ccggtcgatcagagaattcggatgaaacggtataacaccgcctcagcttcacagaaggac
atcaaagatgctctccagcgcccatcgcaaaagtccaatgaagctattgtgggtctggtg
aagcctattattcaagacgtgcgagagaatggagatgccgccgttctgaaatacacccac
aaattcgagagggcaacgtccctcacgtcgcctgttcttcgcgctccattttctgaagat
ctcatgaagcttacaccagagaccaaagaggcgattgatattagtttcgaaaacattagg
cgtttccatgctgcacagaaagaagataaagccctccaggtggagacaatgccgggggtc
gtctgctctcgttttgtccgccctatcggaagagttggtctctatgtccctggcggtaca
gctgtgttaccttctactgcgctaatgctgggagttcctgccatggttgctgggtgtaag
aagattgtcctggcttctccaccacgttcggatggcagtatctcacccgagatcgtttac
attgcacaaaaggttggagctgaaagtattgtgcttgccggaggcgctcaggcggtggcc
gcgatggcgtatggcacggagagcgttaccaaggttgacaagatccttggacctggaaat
caatttgtgacagctgctaagatgcttgtttccaatgacacctcggccggcgtgagcatc
gatatgcctgcgggtcccagcgaggttttggtcattgctgataagcacgcaaatcctgca
tttgttgcatcggacttactcagccaggctgaacatggcgttgactcccaggttatcctg
atcgctgttgatctgaatgatgcagaactggctgccatcgatgatgaattgcatcgacaa
gccagtgagcttcctcgcgtcgatattgtgagaggttctatcgaacactcggtcactttc
gtcgtgagagatatcgaagaggcccttgcgctaagcaacgaatatgcccctgagcacctt
atccttcagatccgggacgccgcaaatgtagtatctatggtagaaaatgctggtagtgtc
ttcatcggcgaatggactccagagagcgttggtgattactctgctggagtgaatcactca
ctaccaacttatggctatgcaaagcaatactccggcgttaaccttgcttccttcgtaaaa
cacatcaccagctccaaccttacggctgaagggctaaggaatgtttcacaggctgttatg
caacttgcatctgtggagggtctcgatgcccatcgccgggccgtcagcatccgtgtcgat
tggatgaagcaaaataagggctag

DBGET integrated database retrieval system