KEGG   Coccidioides posadasii: CPC735_009470Help
Entry
CPC735_009470     CDS       T01332                                 

Definition
SNF2 family N-terminal domain containing protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cpw  Coccidioides posadasii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPC735_009470
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CPC735_009470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 961 aa AA seqDB search
MPFKPFKPPLIRRPPSAPQTQQDTSESVSQPSAKRRRIGDQASDVATEEGVKPNGTVHVV
KSGQALYRKPSILANNSSKLLDKTGRNDTASGDGGVEGYYNVLWRKFTAKKHRTWDGDGI
LSLRGGYAYLQDVSGKDMGRIMFNSPLKPGSALSIGGKDVEVDSILSKEEYLAGRSFLGV
NRESPDVLLKKPELPRMTPISVSRIGSVRKPDATKPAVIGRRVEVREAEEAVKKVLNVAA
PKSIATNSRFKNPLKEDSVLPSKPNKEVTPRHDPNQPGAIVMKRPESVPKDKQIVDVVVD
PLLGKHLREHQREGVKFLYECVMGMRPFNGEGAILADEMGLGKTLQTIALLWTLMKQNPI
YGASPVVKKALIVCPVTLIKNWQKEFRKWLGNDRLGVFVADGKHMRLTDFTMGMSYNVMI
IGYERLRTVQEELAKGRGIDIVIADEGHRLKTVQNKSAQAIQSLNTARRIILSGTPIQND
LSEFFAMVDFVNPGLLGTFKMFMKEFEGPIVKSRQPGASKKDIEKGEARSEELAGLTSKF
ILRRTADILSKHLPPKTEYILFCNPTPAQANIYRHVIASPIFQSALGNSESALQLITILK
KLCNSPSLLTLKVLKDENPNCTISSLISTLPPNLLRHFSPASSGKIRVLDQLLHNLHSTT
SEKIVLVSNYTSTLNLLAALLSSLSLPYLRLDGSTPASKRQFLVDDFNRSSSKSCFAFLL
SAKAGGIGLNLTGASRLVLFDVDWNPATDIQAMARIHRDGQKRHCHIYRMLLRGGLEEKI
WQRQVTKLGLADSVMDQKNSVAHFSREELRDLFRLDEDAECQTHDLLGCECEGRGRDVSI
IADVGDNGDNLSDSESLTESDGSDEIPDPPSLIKASKLLSHPSTGERKNAANKRRRKMRS
LMQYSHISTPLLVTKHRKSLEEQIGDDVLLSLLGEEGNGVRYLFKRDGFAGLSTNTDKMG
I
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgccattcaagccctttaagcctccgctcatccgaaggccgccctccgctccccaaacg
cagcaggatacctctgaatcggtttcccagccctccgctaaacggcgtcgtatcggcgac
caggccagcgatgtagcgactgaagaaggagtgaagcctaatgggacagtacatgttgtg
aaaagtggccaggctctctatcggaaaccgtcgatcttggcgaataactcgtccaagctt
ctcgataagactgggcggaatgacacggcaagcggcgacggcggcgtagagggctactac
aatgttctttggcgaaaatttacggccaaaaagcataggacatgggatggtgacgggatc
ttgtcccttcgaggtggctatgcctatctccaagatgtttctggaaaggacatgggccgg
atcatgttcaattctcccctaaaacctggctcagcgctgtccattggcgggaaggatgtt
gaggtcgactcaatactttccaaggaagaatatctcgccggtcgttcattcctcggcgta
aatagggagtcgcctgatgtattattgaagaagccagagctaccgcgaatgacaccgatt
agtgtctctcgcattggttccgtacgaaaaccagatgctactaagccggcagtgattgga
aggagggtagaagtacgtgaggccgaagaagctgtaaaaaaggtgcttaatgttgcagca
ccaaaaagtattgcaacgaatagtcgtttcaaaaaccccttgaaagaagactctgtactg
ccgtcgaaaccgaacaaagaagtcactccacgacatgacccaaaccagccgggagcaatc
gtgatgaaacgcccagaatcagttccaaaggataagcagatcgttgatgtcgtcgttgac
cctctcctgggaaaacatcttcgcgaacatcagcgcgagggtgtcaagtttctttacgaa
tgcgttatgggaatgcgccctttcaacggtgaaggggccatccttgcggatgaaatggga
cttgggaaaacattacagacaatagctttgctgtggactctaatgaagcaaaatccaata
tacggggcatccccagtggttaaaaaggctctcatcgtatgcccggtgacgctgattaag
aattggcaaaaagaattcagaaaatggttaggaaatgatcgacttggcgtgtttgttgcg
gatggaaaacacatgaggcttacggattttacgatgggaatgagttataatgttatgatc
atcgggtatgaaagattacgaactgtgcaagaggaattggccaaaggtcgtgggattgat
atcgtcatcgcagatgaagggcacagattgaagaccgttcagaataaaagtgcccaggcg
attcaatcccttaatactgctcgacgtatcattctttcgggaacgccgattcaaaacgac
ttgagtgagttcttcgctatggtggattttgtcaaccctggtctgttgggcactttcaaa
atgtttatgaaagaatttgaaggccctattgtgaagtccaggcagccaggcgcgtccaag
aaggacatcgaaaagggtgaggctagaagcgaggagttagcaggtctaacgtccaagttt
atcttgcgccggaccgcagatatcctttctaagcatctcccacccaaaactgaatatatc
ctgttttgcaatccgactcctgcccaagcgaatatataccgccatgtgatcgcctctccg
atattccagtcagcactcggaaactcggagagtgctttgcagcttattacgattctaaag
aagctctgcaatagtccttctttgctcactctaaaagtcttaaaggatgagaacccgaat
tgtacaatcagctctctcatatcgaccctcccacctaatctgcttcgacatttttcaccc
gcatcgagcggcaaaattagagttctggaccagctgctccacaacctgcacagcacaacg
tcggagaagattgtgctagtgtcaaactacacatcaactctcaaccttctcgcggctctt
ttgtcgtctctatccctcccatatctacgcctcgatggttctaccccagccagcaaacgt
caattccttgttgacgattttaaccgctcgtcatccaaatcctgcttcgcatttctcctt
tctgcaaaagctggggggatcgggctcaatctcaccggcgccagccgcctggtgctcttt
gatgtggactggaatcccgcgacggacatccaggccatggcgcgtatccatcgtgacggg
caaaagagacactgtcacatctaccgaatgttacttagaggcggactcgaggagaagatc
tggcaaagacaagttacgaaacttggtctagcagatagcgtgatggatcagaaaaacagc
gtagcgcatttttctagggaagaattgagagatttgtttagactcgatgaggatgccgag
tgtcaaacacatgaccttttaggctgcgagtgcgaggggagaggaagagatgtttcaatt
atagcggatgttggcgataatggggacaacctgtctgactccgagagcctcacggagagt
gacggttcagatgaaatcccagatccgccttcgctaatcaaggcgtctaaacttctcagc
catccatcaaccggcgaaagaaaaaatgctgccaacaagagaagaaggaaaatgcgctct
ctcatgcagtattctcacattagcactccacttctcgtcaccaaacatagaaaatcacta
gaagagcagattggcgacgatgttcttttatcgttactcggagaagaaggcaacggggtc
cgatacttgtttaaacgggatggcttcgcagggttatcgacaaatacagacaaaatgggg
atttaa

DBGET integrated database retrieval system