KEGG   Coccidioides posadasii: CPC735_010580Help
Entry
CPC735_010580     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cpw  Coccidioides posadasii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cpw04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 664 aa AA seqDB search
MEGRDRDSDLTDGQEDESPFSSPAESPLEHNETDAMFPSTTQPPSLRTVSPQTMTPSSTP
LGHINAARRPPPVPTAGQSSGLSQDIQAKMKAFSLSRQGGRSGQNTPSSLSSGGSSSVGT
PSKGALVGGINTNVLGGGPALAGRFPGGLSNAGLSPTGRPQPGGWTSVPSPVGRTPTMTP
KLGGLAAKRGFKQSMKLSDAGGTRPALRAPTSLPEGVTGPHSKAQFAQAQSGFNKYSEII
DTKAGTIRFKDKAVIHGGGIDFTGGHSFSISLDEVETLDELGKGNYGTVYKVRHCRPRLR
RPGLGLRGSMAPHSVHQAENAPNSEDGETDQLSNVVMAMKEIRLELDKSKFTAIIMELDI
LHRCVSPFIIDFYGAFFQEGAVYICVEYMDGGSMEKLYGDGVPENILRKIALSTIMGLKS
LKDEHNIIHRDVKPTNILINTRGQIKICDFGVSGNLVASIAKTNIGCQSYMAPERIAGGV
PSAGPDGGTYSVQSDIWSLGLSIIECAIGRYPYPPESYNNIFSQLNAIVQGDPPTLPDEG
FSSNAKDFVRCCLNKTPSLRPTYATLLRHPWLADLLAPPASLLGGTEGGAAAEINATDRK
GKGPLSAAEFDTADEEVAAWVKEALDKRKRGVMGRHAQPALHKVALDAVPGSPLLDDPAN
LMAA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcgcgatcgcgactctgatctcaccgatggccaagaagacgaaagcccattc
tcgagccccgctgagagtcccctggagcacaatgaaaccgatgcgatgtttccctctacc
acacagcctccttcactccgcaccgtatctcctcaaacaatgactccgtcttccaccccc
cttggacatatcaatgccgccagaagacctcccccggttcctacagccggccaatcgagc
ggtctgagccaggacatacaggcaaagatgaaagctttctctctttcgcgacaaggagga
aggtccggacagaatactccatcctctctttcttctggaggaagtagttctgttgggaca
ccatcaaagggagccttggttggtggcattaataccaatgttttgggtggaggtcctgcg
ctggctggtcgctttccgggcggcttgtccaacgccggattgtcgcccaccggccgaccc
caaccgggaggctggacttccgtgccttctcctgtcggtcgcactccaacaatgaccccc
aagctgggaggtctggcggccaagcgtggctttaagcaaagcatgaaactttccgacgct
ggaggcactcgtccggcgctcagagcccccaccagtttaccggagggggtaacggggcct
cattcaaaggctcagtttgcccaggcacaatctggattcaacaaatactctgagatcatc
gatacgaaggcaggcacgatcagattcaaggacaaggctgttatccacggtggtggtatt
gatttcacaggtggccacagtttcagcatctcgttggatgaggttgagacgctggatgaa
ttgggcaaaggcaattacggtactgtttacaaagttcgccattgtagaccgcgccttcga
agacctggccttggactgaggggttctatggcgccgcatagtgtccatcaagccgaaaac
gccccaaattcagaggatggcgagacagaccagctatctaacgtggttatggcaatgaag
gaaattcgccttgaactggacaagtccaagttcaccgcgattataatggaattggatatt
ctccatcgctgcgtgtctccctttatcatcgatttctatggagcttttttccaggaggga
gccgtgtatatctgtgtcgaatacatggatggaggttccatggagaagctgtacggcgac
ggcgttccagagaatatcttgagaaagatagccctctcgacgataatgggactgaaatct
ttgaaagacgaacacaacatcatacatcgcgacgttaagccgactaatatactcatcaat
acccgaggtcagataaaaatatgtgattttggagtcagtggaaacttggttgcaagcatt
gccaaaacaaatattggatgccagagttacatggccccagagcggatcgcaggcggagtt
ccttctgctggacccgacggcggaacgtacagtgtgcaaagcgacatctggagtttgggg
ttgtcgattattgagtgcgccatagggcgatacccctacccacctgaatcatataacaac
atattcagtcaactaaatgcaattgtccaaggagacccaccaacgcttccagatgaaggc
ttctcatccaacgccaaagacttcgttcgctgttgtctgaacaagactccctcccttcga
cctacatatgccactctcctccgacatccatggctcgctgatttgttggcgccacctgct
tctttgctgggcggaacagaaggtggagctgctgctgaaatcaatgcaaccgacagaaag
ggtaaaggaccactctcagcagcggaattcgacaccgcggacgaagaagttgctgcctgg
gtcaaagaagccctggacaaacgcaagcggggcgtcatggggcgccatgcccagccggct
cttcataaagttgctctcgatgcggtgcccggcagtccacttctcgacgacccggccaat
ttgatggcggcttaa

DBGET integrated database retrieval system