KEGG   Coccidioides posadasii: CPC735_010640Help
Entry
CPC735_010640     CDS       T01332                                 

Definition
Choline/ethanolamine kinase family protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cpw  Coccidioides posadasii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CPC735_010640
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CPC735_010640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 787 aa AA seqDB search
MSILQVTLCASDGSGNGGSISGQPGEDTLDHTVRPFQTSNTQLPTINAENVGDPTSDTRQ
IRQHRASIGGKKVIARTLPHASSSSLNSLSSQMASSKLDGANPSAEDTDPGARSSDESRQ
GQYSLFLQVFSWLQNERTKLATRRQKVGDEHGSAEAPDSNTSESRTDDMEFALDQLERIL
AQYSSSRENIRPRGSMTPKQRAAAVKKLRRGSHSDSDYTDTDQGVPGADVTLDNSKALLY
SGGEADSDVDALEVKPSAKDRENWLKFKFEVVRLVHTLGLKGWRRVPLEVSGEVEVVRLS
GALTNAVYVVSPPKKLPMAQRSETSLPSVPRKPPPKLLLRVYGPQVEHLIDRERELQILR
RLGKRNIGPRVLGTFNNGRFEQYFHAKPLTTKELRVPETSKQISKRMRELHDGIDLLPEE
RESGPSLWKNWDKWVGRCEKVTTWLDQEILNGNNSSKASNEPWRSRGFVCCVPWQSFRAV
VDRYRKWLEEHFGGAGEISKRLVFAHNDTQYGNLLRLQPSEESPLLLPANEHKQLIVIDF
EYASANMRGVEFANHFTEWCYNYHDAERPWACHTNWYPTQEEQERFIRAYLRHQSRLTAQ
PADISTPPATHPSVSVTRPTYTSSPRVPPFLLDTYVPGVNPPLTDYENRDPAEEAEVQQL
LHETRLWRVANSVQWIAWGIVQAHVPGMNIALSKQDTANIPAPGSSVPSEPEKSDEQQST
DYAQEVNHEQVKQEVEAEEAADEFDYLAYAQDRALFFWSDLLALGFIKEEELPADMIEDI
KKRVIDY
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtccatactgcaggtcacactgtgtgctagtgacgggagtgggaatggaggaagcatc
agtggtcaacctggtgaggacacattggatcacactgtcaggcctttccaaacgtccaat
acgcaattgccaacaataaatgcggagaatgtgggcgaccccacgtccgacacccggcag
ataaggcaacatcgtgccagcattggcgggaagaaggtaatagcgcggacattgccacac
gcttcttcttcatctctgaactcccttagcagtcaaatggccagctcaaagctagacggg
gccaacccaagcgccgaggatacagatccaggcgcacgaagctctgatgaatcccgtcag
ggccagtactcgctcttcctgcaagtattcagctggctgcagaacgaaaggaccaagctg
gctactcgaaggcagaaagttggagatgaacatgggtccgcggaagcgccggattcgaac
acttccgagtctagaacggatgacatggagttcgccctggaccagcttgagcgtatactg
gcacaatactcgagttctcgggagaatattcgtcctagaggttcaatgacaccgaagcaa
cgggcagcagcagtcaagaaactacgacgaggatcccattccgattctgactacacggac
actgatcaaggtgtacctggcgccgatgttaccttggataattccaaggcacttctctat
tccggcggcgaggcggatagtgacgtcgacgctctcgaagttaagccctcagctaaggat
cgcgagaactggctgaaatttaaattcgaagtcgtccgtttggttcatacattagggctc
aagggttggagaagggtacccttggaggtcagcggcgaagtagaagtcgtgcgcctaagc
ggagcattgaccaatgctgtttacgtcgtttcaccgcccaaaaaacttccgatggctcaa
agatcagagacgtcgttgccatcagtgccgcgaaaacctccaccgaagcttctcctccgt
gtttatgggcctcaggtggaacaccttatcgacagagagcgcgagctgcagattctccgt
cgtttaggaaagaggaatatcggaccccgtgttttgggtactttcaacaacggacgtttc
gaacagtatttccatgcaaaacctctaaccactaaagaactacgtgttcccgagacctcc
aagcaaatctcaaaacgcatgagagagcttcatgacggcatcgatctactcccagaagag
cgagagagtggaccctccttgtggaaaaactgggataaatgggtcggacgctgtgagaag
gttactacctggctggatcaagagatcctgaatggtaataatagctcaaaggcttccaat
gagccctggagatcgcgcggtttcgtctgctgcgttccatggcagagcttccgggccgtg
gtggataggtatcggaaatggctggaagaacattttggcggcgcaggggagatttccaaa
cggctggtatttgcgcacaacgatacacaatatggcaaccttctccgactacaacctagc
gaagagtcaccgctgttgctccccgccaacgaacataagcagctgattgtcattgacttt
gagtatgcatccgctaacatgcgtggtgtcgagtttgcgaatcattttaccgagtggtgt
tataattatcatgacgcagaacgtccatgggcatgccatacaaattggtatcccacccag
gaagaacaggaacggttcatccgggcatatctgcgtcaccaatcccgtctgacagctcaa
cctgcggacatctccactccacctgcaacccacccatctgtttcagttacccgaccaact
tacactagcagcccgcgtgtacccccattccttcttgatacttacgttcctggagtgaac
ccgcctctcacagattacgagaatcgtgatccagccgaagaagctgaagtgcagcagctt
ctccacgagacacgtttgtggcgggttgcgaactcagtgcagtggatagcatggggaatc
gtgcaagcacatgtccccggaatgaatatagctctttctaaacaggacaccgcaaatatt
ccggcccctggaagctctgttcctagcgaaccagagaagagcgatgagcagcaatcgacc
gattatgctcaggaggttaaccatgaacaggtgaagcaagaagtcgaggctgaagaggcg
gctgatgagttcgactatctcgcctacgcgcaggatcgggctctttttttctggtccgat
ctactggcattgggattcataaaggaggaagaattaccggcggacatgatagaagatatc
aagaaacgggtgattgattattaa

DBGET integrated database retrieval system