KEGG   Coccidioides posadasii: CPC735_011400Help
Entry
CPC735_011400     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cpw03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 739 aa AA seqDB search
MAPSFDTLSEQDLHEEEVEIDFSDLKAQYEVRLEEGLDAFVVIDGLPIVPEESKPKLIKF
LLKKLNTVGRTREDAIFMPLNEKGMSEGFAFVEYDTPEQAIAATKHLHGTPLDKKHTLAV
NKLTDIDRYGREGRVDEEYTPPKIEPFQEKEHLRSWLGDPNARDQFAMYRGDKVGVFWNM
KNNPPENVVDRDHWTQLFVQWSPLGTYLASVHPQGVQLWGGPQFGKQKQFPHPFVSLMEF
SPGEKYLTTWSSRPIQLDGPPGALSYEEEGKNIIIWDITTGKPLRSFVSHELAAPAGPDG
DAAQAKKKVQWPAFKWSADEKFVARMLPGQSISIYELPRMNLLDRTSVKIEGVMDFEWSP
ATVQREGVKQSEQLLSFWTPEIGSNPAKVGLMSIPSKEVVRTRNLFNVSDVKLHWQSQGA
YVCVKVDRHSKSKKSLATNLEIFRVREKGVPVEVVDSLKDTVINFAWEPKGNRFVLITTG
EVPTGTAVPPKTAVSFFAPEKTKSGAAGNFKLVRTIEKKTSNGIYWSPKGRFVVVATVHS
QQHFDIDFWDLDFEGEKPENEKDLSANLQLMKTNEHFGVTDIDWDPTGRYVVSSASAWTH
SLENGYHIHTFSGTTLAEHAVEKFKQLVWRPRPPTLLSKEEQKKVRRNLREYSREFDEED
KYAVDIANTAIVEMRKRLLNEWTAWLKKEKEMVEEEREVLGLPKYEEEPAAKPTPGAEDD
TIVEEIVEEIIEESEEIVA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaagttttgatactctctcggagcaagacctccacgaggaggaggttgagatc
gacttttcagatctgaaagcgcagtatgaggtccgactggaagagggcctcgacgccttt
gttgtgatcgacggacttccaatcgtccccgaagaaagcaaaccaaaactcatcaagttc
ttgttgaaaaaattaaacaccgtcggcagaacgagagaagatgccatcttcatgcccctc
aacgagaagggcatgtctgaaggctttgccttcgttgaatacgacacccccgaacaggca
atcgccgctacgaaacacctacacggcactcccctggataagaagcatacgttggcagtc
aacaagctgaccgacatcgatcgctatggacgagagggccgtgtcgacgaggaatatacc
ccgccaaagatcgagccgttccaggagaaggagcatctgcgatcctggctcggagacccc
aacgcccgtgaccaattcgccatgtacagaggcgacaaggtcggcgttttctggaacatg
aagaacaacccgcccgagaacgtcgtcgaccgcgaccactggactcagctcttcgtgcaa
tggtctcccctcggtacctacctcgcctccgtgcatccccagggcgtacagctgtggggc
ggcccccagttcggcaaacagaagcagttccctcatcctttcgtttctctgatggaattc
tcgcccggtgaaaaatacttgactacctggtccagccgcccgatccagcttgacggacct
cccggtgcgctctcctacgaggaggaagggaaaaacattataatctgggacatcacgacc
ggaaagccacttcgatcattcgtttcccacgagctcgctgctcccgctgggcctgacggt
gacgctgcccaggccaagaagaaggtgcagtggccggccttcaaatggtcggccgatgag
aagtttgtcgctcgcatgctcccaggccaatccatctccatctacgaactaccccgcatg
aatcttctagatagaacatcggtcaagattgaaggtgtcatggacttcgaatggtcccca
gcgaccgttcaacgtgaaggagtcaagcagtctgaacagctactctccttttggacccct
gagatcggtagcaatcctgccaaggtcggcttgatgagcatcccctccaaggaagttgtc
cgaacacgaaatcttttcaatgtttccgatgtcaagttacattggcaatcccagggagca
tacgtctgcgtcaaggtcgacagacattccaagtccaagaagtcgttggccaccaacctc
gagatcttccgtgttcgcgagaaaggtgtccccgtcgaagtcgtcgactcgctcaaggat
accgtcattaacttcgcttgggagcctaagggcaaccgcttcgttctcatcaccactgga
gaggtacctactggcaccgctgttcccccgaaaactgcagtctcgtttttcgctcccgag
aagacaaagagtggtgctgctggtaacttcaaactcgttcgtaccatcgaaaagaagact
agtaacggcatttactggtcacctaagggtagattcgtcgttgttgctactgtccactct
caacagcacttcgatattgatttctgggatctcgactttgaaggcgagaagccggaaaat
gagaaggatttgagtgcaaacctgcagctaatgaagactaacgagcactttggcgtcact
gatattgattgggacccaacaggtcgttatgttgtctctagcgccagtgcctggactcac
tcgctcgaaaacgggtaccatatccacaccttctccggaaccacactcgcagaacatgct
gttgagaaattcaagcaactagtctggcgcccacgacctccaacacttctctccaaggag
gaacaaaagaaggtccgacgaaacctccgtgagtactcccgcgaattcgacgaagaagac
aagtacgccgtcgacatcgcgaacaccgctattgtcgagatgcgtaagagactgcttaac
gaatggaccgcctggctcaagaaggagaaggagatggtcgaagaggagcgtgaagttctg
ggactgcccaagtacgaagaagaaccggctgccaaacctactcccggtgccgaagacgat
actattgtggaagaaattgtggaagagatcatcgaggaatcggaggagattgttgcatga

DBGET integrated database retrieval system