KEGG   Coccidioides posadasii: CPC735_011570Help
Entry
CPC735_011570     CDS       T01332                                 

Definition
4-alpha-glucanotransferase, putative
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cpw  Coccidioides posadasii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPC735_011570
Enzymes [BR:cpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CPC735_011570
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CPC735_011570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1403 aa AA seqDB search
MPVESLSIFSIVSKFMGKFPADWNKHLQGIGQRGYNVVHFTPLMTRGASNSPYSIYNQLE
FDRQCFPNGESDVIDMVTRMEKEYGLLALTDVVWNHTAHNSKWLQEHPEAGYNVETAPWL
EAALELDDALLSYGNALQSLDLPTEFKTVEDLVSVMQQMRPHVIEKIKLWEFYSVNVQRD
TEAIIKAWKSGNLDYPKGGFGEVGVGGLSEIRQWPFEKKAAFLREKALENDNQILGRYSR
KVNPRIGAALITALYGRYDETTADIPVVEENVFKTLDSLNLPLFREFDDDVSEIFDQLFH
RIKYLRLDDHGPKLGPVTPKNPLVETYFTRLPLNDITKAHSPRSLALVNNGWVWNADALR
DNAGPGCRAYLKREVIVWGDCVKLRYGNCPEDNPFLWDYITRYTKLMAKHFAGFRIDNCH
STPLPVAEYLLHEARRIRPNLMVYAELFTGSEKVDYLFTKRLGLTALIREAMQAWSAAEL
SRLVHRHGGLPIGSFDPSLLSHWCQMETKVVLHHIRPTTVHALFMDCSHDNETPAQKRDP
RDTLPNAALVAMCASAIGSVMGYDEIYPEHVNLVTETRSYHSVFSENGVQDATGEGGIGG
IKKLLNSLHTEMAIDEYDETHIHHDAEYITVHRVHPHTRKGTLLISRTAFSASNVKHILA
PIHLTGTKASLLGAWKLEVENDTEAKRIVAADEKYLRGLPSRVSEISGFRLEENGDDTII
YTPDDFPPGSIALLKTHIHERDLPVDLSKFITADADATFRSVDLTGLNFTLYRCDSEERD
SSGGKDGVYKIPNFGPLVYAGLQGWWSVLEEIIKTNDLGHPLCDNLRAGQWALDFVVGRM
RRAITQQGYSQLEGPTKWLEDRFNAVRRVPNFLLPRYFTIIIKAAYDAACRHAIHCLGVI
IEHGQHFIHELALVSVQHLGEVKSASLYPTNQVPCLAAGLPHFATDWARCWGRDVFISLR
GLLLATGRFDDAKEHILAFASTLKHGMIPNLLSSGKFPRYNSRDSVWFFLQAIQDYTHIV
PNGIRILEENVPRRFLPYDDTWFPFDDKRAYSRSSTIAEIIQEVFQRHASGISYREHNAG
PELDLQMKPEGFQVDVHVDWETGIIFGGNQWNCGTWMDKMGESVKAKNQGYPGTPRDGAP
IEISGLLYSALRWVSDLRRKGHYPYSGVDIESGLTITFDDWATRVKTHFEKCYYVPVDSE
EDRDFNVDSKLVNRRGIYKDIYKSSQPYEDYQLRPNFTIAMTVAPDLFDAERGFHALTIA
DVVLRGPLGMATLDPTDLNYRPYYNNSEDSTDFATSKGRNYHQGPEWLWPTGYFLQALLK
FSLLRNSSHQSLMDISQQITMRLERCCKSLRESTWKGLTELTNKNGEFCVDSSPTQAWSA
ACLLALYYDASEIQKARSASLSV
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgagtctctttcgatattctccatcgtctccaaattcatgggcaagttcccg
gcggattggaacaaacatcttcagggaattgggcagcggggatataatgttgttcatttt
acgcccttaatgactcgaggggcgtcaaattctccgtacagcatatacaatcagttagag
tttgatcgccaatgttttccgaatggagaaagcgatgttatagatatggtcacgagaatg
gaaaaggagtacggactgcttgcattgactgatgttgtatggaaccatacagcacataac
agcaaatggctccaggaacatcccgaagctggctataatgtggaaactgccccttggtta
gaagctgccctggagttggacgacgctctgttaagttatggaaatgcgttgcaaagtcta
gatttacccacagagtttaaaaccgtcgaggatttggtttccgtcatgcagcagatgagg
ccacatgttattgaaaagattaagctttgggaattttactcggtcaatgttcagcgtgat
acggaggcaatcatcaaagcctggaaatctggaaatcttgattatccaaaaggcggcttc
ggggaggtcggagtaggaggcttaagcgaaattcgacagtggccgtttgaaaagaaagct
gctttcctacgtgaaaaggcacttgaaaatgacaaccagattttagggagatacagcaga
aaagtaaatcctcgaatcggtgctgcactcatcactgcgctatacggtcgatacgacgaa
acgacagcagatatacctgtcgtggaagagaacgtcttcaaaactttggattctctgaat
ttgccactgttcagagagtttgacgacgacgtctcggaaatatttgaccagttattccat
aggatcaagtatctacgcctcgatgaccatgggcctaagctgggccccgtcactccaaag
aatccactcgtcgaaacgtattttactcgtcttccgttgaatgatatcactaaagcgcat
agcccaaggtcgcttgccttggttaacaacgggtgggtgtggaatgccgacgctttaagg
gacaacgctgggccgggttgtcgggcatacctaaaacgtgaagttatcgtttggggggac
tgcgttaaactgcgttatgggaattgtccggaggataatccatttttatgggactacata
actcgatatacaaagttaatggcgaaacattttgcaggatttcgcattgataactgtcac
tccacacccctgcccgttgcggaatacttgttacatgaggctcggcgtattcgtccgaac
ttaatggtttatgcggagctattcacgggttccgagaaggttgattatttatttacaaaa
cgacttggattgacagcgttgattagagaagctatgcaggcatggagcgctgctgagtta
agtcgattggttcatcgccacggtggtcttccaattggcagctttgatccaagcttgtta
tctcactggtgtcaaatggagaccaaagttgtcctccaccatattcggccaactacggtg
catgctcttttcatggattgttctcatgataatgaaactcctgctcaaaagcgagatccg
agggatacattgcccaatgcagctctggtcgcaatgtgcgcttctgcgattggaagtgtc
atgggttacgatgagatatatcctgagcatgtgaatctcgtcactgaaactcgctcatac
cattcagtcttttcagaaaatggcgtccaagacgccactggcgagggaggtattggtgga
ataaagaagcttttgaacagcctgcatacagagatggcgattgacgaatatgatgagact
catattcaccacgatgcagagtacataacggttcacagggtacatccacacacgagaaaa
gggacactacttatatcacgtaccgcattttctgcgtctaatgttaagcacatcctcgct
ccaattcacttaacaggcaccaaagcatcacttttaggggcctggaaattggaagttgag
aatgataccgaagctaagcgaattgtagccgctgatgagaagtatctgaggggtttgccc
agccgtgtttctgaaatatctgggtttcggcttgaagagaatggagatgatacgataata
tatacccccgatgattttccaccgggctcaattgctttactaaaaacacatatccatgaa
agagatttaccggtggacctgagtaaatttatcaccgctgatgcagatgcaactttccgc
tctgttgatcttaccggcctgaatttcaccttgtatcgctgtgattccgaggaaagagac
tccagcggcgggaaggacggagtctacaagatcccaaattttggccctcttgtttatgct
ggccttcagggatggtggagtgttctcgaagagataattaaaacgaatgacctaggtcat
ccactctgtgataatcttagagccggccaatgggcgcttgactttgtcgtcggaaggatg
cggcgggctatcacgcaacagggttactcacaacttgaaggaccgacaaagtggctcgaa
gacagattcaacgctgtacgtcgagtaccaaatttcttgctgccccgatacttcaccatc
attatcaaggctgcatacgatgcagcttgcagacatgcaattcattgtctcggggttatt
attgagcatgggcaacatttcattcacgaactggcgctggttagcgtacagcatctgggg
gaggtcaagtctgcttcactttatcccacaaatcaggtgccttgccttgctgccggtctt
cctcattttgcaacagactgggcgagatgctggggccgcgatgtcttcatttcgcttcgc
gggttactcctcgccactggacgctttgacgatgcaaaagagcatatcctagcctttgca
agcacgttaaaacatggcatgatacccaacttactttcgtctggaaagttccctagatac
aactctcgtgattccgtttggttcttcctgcaggctattcaagattatacccatatcgtt
cccaatggtattcgaattctggaggaaaatgttcctcgacgattcttaccctacgatgat
acttggtttccgtttgacgataagagagcgtatagtagaagttcgacgatcgcggaaatt
atccaggaggtcttccagaggcatgcatcgggtatctcgtatagggagcacaacgctggt
ccggagctggacttgcagatgaagcccgagggatttcaggtggatgtccatgttgactgg
gagaccgggattatattcggagggaatcagtggaattgcgggacatggatggataaaatg
ggagagagcgtaaaggctaaaaaccagggatatcctggtactccaagagacggcgcaccg
attgaaatttctgggttgctctacagtgcgctgcgctgggtgtccgatctacggagaaag
ggccactacccgtactcaggtgttgacattgagtctggactaacaattactttcgatgac
tgggcaacgagggttaaaacacacttcgaaaagtgctactacgtccctgtagactctgag
gaagaccgggacttcaacgtggacagcaaactcgtgaaccgtcgcggaatatataaggat
atatataaatctagtcaaccttatgaggactatcagctccgccccaactttactattgcg
atgactgttgcacctgaccttttcgatgcagaaagggggtttcatgctctgaccatcgct
gacgttgtccttcgcgggccactggggatggcaacgcttgacccgaccgacctgaactac
aggccatattataacaactcggaagactctaccgattttgcaacttcgaaggggaggaac
tatcatcagggccccgaatggttatggccaactgggtactttctccaagcgctgttgaag
ttttctctgttgaggaatagttcacatcagagcttgatggacatatcccagcagattacc
atgcgactggagagatgctgcaaatctctgagggagagtacatggaaaggtctgacagaa
ttgacgaataagaacggggaattttgtgttgattcgtcaccgacccaggcgtggtctgca
gcgtgtttgctggccctgtattatgatgcttctgagatccagaaggcaaggtcggcttcc
ttgagtgtctaa

DBGET integrated database retrieval system