KEGG   Coccidioides posadasii: CPC735_012300Help
Entry
CPC735_012300     CDS       T01332                                 

Definition
glycerol kinase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpw  Coccidioides posadasii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cpw00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MAKDIESFIGSIDQGTTSSRFLIFNKNGEVVASHQLEFTQIYPQPGWHEHDPKEIVTSVE
RCIDGAVSSFEHQGYNVESIKAVGITNQRETTVVWDKETGEPLYNAIVWTDTRTQSLIRR
LKRRLGHGEVHEHCGLPLSTYPSVGKLLWLLENVPKVKDAYEKGVLAFGTIDTWLVYMLN
GGPKKNVFVTDPSNASRTMFMNIRTRQYDETLIDFFRLDEGKLHLPKIISSSDPTGYGSL
ASTVLKGVPITGCLGDQSAALVGQKGFTPGKAKNTYGTGCFLLYNVGEKPVISRHGLLTT
VAFDFGGQAMYALEGSIAVAGSSVKFLKDNFEFISSSDEVNKLAETVEDNGGCVFVTAFS
GLFAPYWMDDARGTIFGITTYTKRGHIARATLEATCFQTKAILDAMSKDSGHALTELAVD
GGMCNSDLTMQTQADLISIPVIRPAMRETTAFGAAIAAGLAVGLWEGIEELQNVNTDGQT
VFRPSIQKEEAEERFLRWEKAVRMCQGWSG
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagatattgaatcattcattgggtcgatcgaccaaggcacaacaagctccagg
tttttgatattcaacaagaacggagaggtggttgcatcccatcagttggagtttacccag
atatatccacagccgggatggcacgagcatgatccgaaggagatagtgacatctgtagag
aggtgtatagacggtgctgtatccagctttgaacaccaaggatacaatgttgaatctatt
aaagctgtcgggattacaaaccagagagaaaccacagtcgtgtgggacaaagagacaggg
gagccgctttacaatgcaattgtttggacggacacacgtacgcagtcgttaattcgcagg
ttaaagcgacggttaggccatggggaggtccacgagcactgtgggctgcctctctcgacc
tatccttcggtaggaaagctactttggcttctggaaaatgtgcccaaagttaaagatgcc
tatgaaaaaggcgttcttgcttttggaacaattgatacctggttggtatatatgctcaat
ggcggaccgaaaaagaatgtattcgtgaccgatccgtcaaatgcgtcgagaacgatgttc
atgaacatcagaactcgccagtacgacgaaactctgatcgactttttccggttagacgaa
ggcaaattacatctcccaaaaataatatcctcgtctgatccaacgggatatgggtcgctg
gcatcaactgttttaaaaggtgttcctattacgggctgccttggggatcaatctgcagcc
cttgtaggccagaaaggctttactcccggaaaagccaaaaacacgtacggcacgggctgt
tttttgctctataatgtgggtgagaagccggtgatatctcgtcacggtcttctcaccaca
gtcgcattcgactttggtggtcaagcgatgtatgcactggaaggcagtattgccgtggct
ggctcgagcgttaaattcctcaaagacaatttcgaattcatcagttcatctgacgaggtc
aacaagctggcggagacggtggaagacaacggtggatgcgtctttgttaccgcgttcagc
ggtcttttcgccccgtattggatggatgacgccaggggaacgatcttcggcatcaccaca
tatacaaagcgtggacatatcgcccgtgcaaccctggaggcgacatgtttccaaacaaag
gccattctcgatgccatgtccaaggacagtggccacgccctaacagagttggctgtggat
ggtgggatgtgcaatagcgacttgacgatgcagacacaggcagatctcatctctatccca
gttattcggccggcaatgcgtgaaaccactgcttttggagctgccattgccgcaggttta
gcggtgggactctgggaaggcatcgaggaactgcagaatgtaaacacggatgggcaaacc
gtatttagaccaagcattcaaaaagaagaggctgaggaacgttttttgagatgggagaag
gccgtccgaatgtgtcaggggtggtcaggctga

DBGET integrated database retrieval system