KEGG   Coccidioides posadasii: CPC735_012510Help
Entry
CPC735_012510     CDS       T01332                                 

Definition
Inactive isocitrate lyase, putative (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPC735_012510
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CPC735_012510
Enzymes [BR:cpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CPC735_012510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 601 aa AA seqDB search
MLRNASRCLSRQLRQAARPSVVPRCSAAGRLAYTSVRMASQLPPVKPPVSVEFPADSYQL
LSTSEKAGAAEDALFEQEVNAVKEWWASPRYEGIKRPYSAEDVVSKRGSLQQSYPSSLMA
RKLFNLLNDKAAKGEPLHTLGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDFG
DYPYNTVPNQVQRLFKAQQMHDRKHWDARRKMTAEQRKTTQYVDYMRPIVADGDTGHGGL
TAVMKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPISEHINRLVAARFQWDLMGT
ENLVIARTDSESGKLLSSTIDVRDHEFILGVTQDTAPLSEELQKMELEGASGAEIDKFEM
KWVKEHKLVTFDEAVEQHLVSEGASKATIDEYKAKVRENRDMSISERRAFADTLAKCPVF
WSWDIPRTREGFYHYRAGEAAATKRAINFAPYADLLWVETGDPNVSKAAGFAAEIRNKFP
GKKLVYNLSPSFNWMGQGFDEASLKSFIWDLAKHGFVLQLISLAGLHTNATIATELSRGF
KKDGMLSYVNLVQKREKEMGVDVLTHQKWSGAPYVDGVLGSILSGSSSNKSMGEGNTESG
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcaacgcttcccgctgcctgtcgagacagctccgacaagctgcacgtccctct
gtcgtccctcgctgctctgccgctggacgtctggcctatacctccgtcagaatggcctcg
cagcttcctccggttaagccaccggtgtctgttgaattccccgcagactcgtaccagctg
ctgtccacgtcggagaaggccggcgccgctgaagatgccctcttcgagcaggaggtgaac
gccgtcaaggagtggtgggcttctccccgctatgagggcatcaaacggccctattccgca
gaggacgtcgtcagcaagagaggatccttgcagcagtcatatccaagctcgttgatggct
agaaaactgttcaatctactcaacgacaaggctgctaaaggcgaaccgctgcacaccctt
ggcgcaatcgaccctgtacagatgacgcagcaggctcccaaccaggaagtgttgtacatc
tccggatgggcttgctcttccctcctgacgaccacaaacgaggtctccccggatttcggt
gactatccgtacaacaccgttccgaaccaggtgcagcgattgttcaaggcccagcagatg
cacgatcgcaagcactgggatgccagacggaagatgactgctgagcagagaaagactact
caatacgtcgactatatgcgcccaatcgttgctgacggtgacacagggcacggaggcctg
acggcggtgatgaagctcgctaagctcttcgccgagaacggcgccgcggccgtccacttc
gaggaccaacttcacggaggcaagaagtgcggccatctcgctggaaaggtcttggttcca
atctccgagcatatcaatcgcctggtggctgccaggttccaatgggatctcatgggaacc
gagaatttagtcattgctagaaccgactctgaaagcgggaagcttctcagcagcaccatc
gatgttcgagaccacgaattcattcttggagtcacacaggataccgcgccactgtcagaa
gagttacagaagatggagctcgaaggcgcttcgggtgccgagatcgataaattcgaaatg
aaatgggttaaggaacataaactggtgacatttgacgaggctgtggaacaacatctcgtc
tccgaaggagcctccaaggccaccattgacgaatacaaggcaaaggttcgcgaaaacaga
gacatgtccatttcagaacgccgggccttcgcagacaccctcgcgaaatgcccggtcttc
tggtcatgggacatcccaagaacccgagaaggtttctaccattatcgcgccggtgaagca
gcggccaccaagcgcgccatcaacttcgctccctacgctgatctcctctgggttgaaacc
ggcgacccgaacgtcagcaaggcagctggattcgccgccgagatccgaaacaagttcccc
ggaaagaagctggtctacaaccttagcccgtcgtttaactggatgggacagggctttgac
gaggccagcctgaaatcattcatctgggacctcgccaaacatggattcgttctccaactc
atctcgcttgccggtctgcacaccaacgctactatcgcaacggagctctcaagagggttc
aagaaagatggcatgctatcatatgtcaatctcgtccagaaacgcgaaaaagagatgggc
gttgacgttctgacccaccagaagtggagtggtgctccctacgtcgatggagttctgggc
tccattctcagcggcagcagctcgaacaagagcatgggcgaaggaaacacagagtcaggt
ttctaa

DBGET integrated database retrieval system