KEGG   Coccidioides posadasii: CPC735_016540Help
Entry
CPC735_016540     CDS       T01332                                 

Definition
Protein disulfide isomerase (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cpw  Coccidioides posadasii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CPC735_016540
Enzymes [BR:cpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPC735_016540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MARLSSLLVASLALLTNVVNADSAVLDLIPSNFEKVVLGSGKPGLVEFFAPWCGHCRNLA
PVYEQLGHAFAHASDKLHISKVDADAHKSLGKKNKVQGFPTLKWFDGKSAEGEEYEGGRD
LESLAKFVTDKTGVKPKGIKKAGDSVVKMLTDQSFAKEVGGDKHVFVAFTAPWCGHCKTL
APTWEALTEDFMREPDVLIAKVDAEAEQSKATARDQKVTGYPTIKFFPKGSKEGETYSGP
RSEDALVNFVNEKCGTHRAVGGGLNAKGGAIEALDDIVARYVSGGAIAEIAKDIKAAAGD
LKQKYAQYYVKVATKLSENSGYAAKELARLEKMKSKGSLAPEKLDDLVSRSNILRRFLGK
EGKKGAKDEL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctcgattgagcagcctcctcgtggcctccctggctctcctcaccaatgtcgtcaat
gccgactccgccgtcctcgatctaatcccctccaactttgaaaaagtcgtccttggatcc
ggcaagccgggactcgtcgagttcttcgccccctggtgcgggcactgccgcaaccttgct
ccggtctacgaacagctcggccacgccttcgcccatgcaagtgataaactgcatatcagc
aaggttgatgcggatgcgcataagtctctaggcaagaagaataaggtccagggcttccca
acgctgaaatggttcgatgggaagagcgctgagggtgaagagtatgagggtggaagggat
ctggagagcctagccaagtttgttacggataagaccggcgtgaagcccaaagggataaaa
aaggctggggacagcgtggtgaagatgttgacggatcagtcgtttgcgaaggaagttgga
ggagataagcatgtttttgtggcctttacggctccatggtgcggtcactgcaaaaccctg
gctcctacatgggaagctctcactgaggatttcatgcgtgaacctgacgtccttatcgcg
aaagtcgacgctgaagcagaacagtcgaaagccactgcccgcgaccaaaaggtcactggc
tacccaacaattaaattcttccccaagggttctaaggaaggcgagacctacagtggtccc
cggtctgaagacgctctggttaatttcgtgaacgagaaatgcggaacacaccgtgccgta
ggaggaggattgaatgccaaaggcggggccattgaagctctcgatgatattgtagccaga
tacgtttccggaggagcaattgctgagattgcaaaggacattaaggctgccgcaggagat
ctcaagcagaaatatgcgcagtattatgtcaaggtggccaccaagctttccgagaattct
ggatatgctgctaaagagctggcgagattggagaagatgaagagcaagggtagcctggcc
ccagagaaattagacgatctggtctcaagatccaatatcttgagaagatttttgggcaag
gaaggaaagaaaggagccaaagatgagctttga

DBGET integrated database retrieval system