KEGG   Coccidioides posadasii: CPC735_016900Help
Entry
CPC735_016900     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CPC735_016900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1664 aa AA seqDB search
MDGDPALDGLRGLYQDLSALSRNALPNVDRLVLELQATVGDFRKLLDKDPKKNESRQAVL
SGKITLENLEYSLNDDFQQAVLQVADALDIDEIQAAAYYLQAQLDSVKLDRSPVMVAIIR
FHERRAFLLECLRLILRESFEIEREDTRALMQDIVAMILEIQNGPLRNGSLYARKCMDSM
GDIERWLVLLGEQIQKASIVGQAQASDVLEVIEYQRHSLGRQHESLGAILSYLFKGTFTS
SEDFRKLLEKLKKNERFDMLLIHYIPALISAISQYGSSEGQGPLREARSLHLAITGNKES
TSCALPKFHAAVVVLWLVEYAGWYFDSGPASPLQGINPGDELAALTQMFMAALEDGGLEF
ILLVCSGITSEEWVAPARNELVGLLLKDAASLTVEPDAPSPYFRDLLMEGLETFTESLIA
NMPDAIRQLRSEEDLQRLDQMTALREATNTSLHRGLVEPRMHLESLLVIIAFTFDHRDEA
AQEFWADTDSNLYGFLQWVSKRQTVPRVSAFCEMLCSLSGGEENSASAHRFLLDEDASSS
KFRRSASMNWDQMFAELQLYATRVTERPSAAQPSILRNRKPESVDIDEPESPVMLTCYLR
LISHLCKENGQIRDWILQHPTANLSNTLLTLCAAPIPHHLRAAIFVTLRCLMIRRTAVHG
NEMWALIDQWISGSGASPLSLTKLPALSSSPALNERHAFQRIMESFDQTNAFVELLTILV
SPTVDLPGSHICLHFPESLGSSYRMPGIEPYIDFVMGQALANKSTVLDGKEARLLQWNCL
SFAATCVESFNENLVSLVNQTTISANTTVGSVPLPTYLRLHPFSRVMEWMFNEDVLRALF
SCSHQDIDDVANASSDSMLLCSLIRSIEVMNLILDHQATFFDIVRPFIRSFPQQGMSTMA
NASLASFEDSMMDNLSLISDLCLYCGTGHPQLTLVSLALLEKLSASRKLNRPTATFSQWQ
TSNQIVELLNTNVDADRIARSLAAQMASDIRELENGPEASGYLIKLGLVQLLDRCLKAIP
NKPTVAHVLLGFRCVGSSLDVAPGSLFDNGLSLLHAISDFVRTYPDGNQGMITSWMVHLK
RLAFQVLQYLWTSALSSPLILPQLRANRLLANILISQPVIGPDLLWDEFRITVPEFWFTE
SAVALSEFLVYRSIIFDYATTEIRAVFNKSSPSFQKDILSTLLGASVAEDGQTISHPSIF
DLFDFADLDIDWAYAFPDLKFFRDVDVSLCTTPQQDGHPVLYDLPSVESLLQLAKDHLVS
AGQVNAQEEDQISSERDKLLLFLRATNQSCQVRYNRLVALRSWVELVITVLITCDMEPAR
MVTLILHTLQAILPKLESSFAGNAAEAIELARLAETLVEKLDTVSTNSTEDVIDERLHHL
FQACIRGIPNILEETVLRETFYHICSRYLTRITQRSTAKARFGPRAQQVIKSTGSGLVDT
ICDDAYSGDEGCRVSALILLNLLSVLDEQQSSSILVTLISQSNYLSMFLGVIRAMASEFR
NTQAAQTAQLLLFYEALLSLLQQLSQTKMGAIRLLDAGLFQAVKESQIFAADPDIGLDID
NPDALRKYYDLLLSVLRVIVSTVFTRGLHNNQIVEQTRNFLSENRQSMVGIFKRYAKIGG
LEGVGTQESLEELVKSYVALIAAVDFLEFEEEQSEQPAGRKLFS
NT seq 4995 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgatccggcactggacggccttcggggcctttaccaggacctttcagctctc
tcaagaaacgccttacctaatgtggatagactggtgttggagttgcaggcaactgttgga
gattttaggaagctcctagataaggatccgaaaaaaaatgaaagccgtcaagctgttctc
tctgggaaaatcacccttgagaacttagaatactccctcaatgatgattttcagcaagcc
gtgttacaagttgcggatgcattggatatcgacgagatacaagccgctgcttattattta
caagcccaattggattcggtaaagcttgaccgttctccggtaatggtggcaataatccgc
ttccacgaacggcgcgcctttctcctcgaatgccttcgtcttatcttacgggagtccttc
gaaattgaaagagaagacactcgtgcacttatgcaggatatagttgcgatgattcttgaa
atacagaatggcccgctgcgcaatggctctctatatgctagaaagtgtatggattcaatg
ggggacattgaaaggtggctcgtcctcctcggtgagcaaatacaaaaggcttcaatcgtt
gggcaggcacaggcttcggacgttttagaggtgatcgaatatcagcgtcacagtctcgga
aggcaacatgaatcgttaggggcaattttatcctacctttttaaagggaccttcacgagt
tcggaagatttccggaagctgcttgaaaagcttaagaagaacgaaagattcgatatgctt
ttaatacactatattcctgcccttatttctgccatttcacagtatggttcttccgaaggc
caaggcccgctgcgagaagccagatctttgcacctcgccatcaccggcaataaagaatcc
acgagctgtgcgctgccgaaattccatgccgcagttgttgtactttggctagtagaatat
gctggctggtactttgatagtggcccggcatccccacttcagggaatcaatccaggcgat
gagctcgcagctctcactcaaatgttcatggccgcccttgaagatgggggtctagagttc
atccttttagtttgttcaggcattaccagtgaagagtgggtcgctccggcaagaaacgaa
ctggttggcttactcctaaaagatgctgcgagtctgactgttgaaccggatgctccctcg
ccctattttcgtgatcttctgatggagggtttggagacgttcacagaatccttgatagct
aacatgccggatgcgattcgccaactaagatcagaggaagatttgcaacggttagatcaa
atgacagcgctccgcgaagcgacaaatacgtctttacaccgtggtttagtcgaaccccgg
atgcatctagagtctctgctagtaatcattgcattcacgtttgaccatagggacgaggca
gctcaggaattttgggcagacactgacagtaatctctatggattccttcagtgggtatct
aagcgtcaaactgtgcctcgtgtcagtgctttctgtgagatgctgtgttcgctttctggt
ggtgaagagaattcggcttcagcacacagattcttgctcgatgaagacgcctcctcctcc
aaattccggcggtcagcctcgatgaactgggatcaaatgtttgccgaattacaattatat
gccaccagagttaccgagcggccatcagcggctcagccgtcaatccttcgcaaccgaaaa
cccgagtcagtggacattgacgaaccagaaagcccagtcatgcttacttgttacctgcga
ctcatcagccacctttgcaaagaaaacgggcaaatacgcgattggatcttgcagcatccg
accgctaacctttcgaatacgctcctcaccctttgtgcagcaccgattccccatcattta
agggctgctatttttgtgactctgcgttgcctgatgatacggcgaacagcagttcatgga
aatgagatgtgggccttgattgatcagtggatttctggctccggggcgtcccccttatca
ctcacaaagttgccagctttatcaagctcccccgccctaaacgaacggcatgcttttcaa
agaatcatggaaagctttgaccaaaccaatgcctttgtcgaacttttgacgattttagtg
tctcctactgttgatctaccaggttcacacatatgcctccacttccctgaatcgctaggt
tcgtcataccgaatgcctggaatcgagccgtacatcgactttgtcatgggacaagccctt
gctaataaatcaacggttctcgacgggaaggaggcgcgacttctgcaatggaactgccta
agcttcgccgccacctgcgtagaatcattcaatgaaaacctcgtatctcttgtgaaccaa
actaccatctccgccaatacgaccgttggaagcgttcccttgccgacatatctccgtttg
catcctttctctcgagttatggaatggatgtttaatgaagatgtcttaagagcacttttc
tcttgctctcatcaagatatcgatgatgtggcaaatgcttcatcggactctatgttactt
tgttcgctgatccgcagcatcgaggtgatgaacttgatattggatcaccaagccacattc
ttcgatattgtgcgcccttttatcagaagctttccgcagcaagggatgtcaaccatggca
aatgcctctcttgcctcgttcgaagacagcatgatggataatctgagcctcatatctgat
ttatgcctatattgcggaaccggtcacccgcaactaactcttgtctctctagcacttctg
gagaagctgtcggcgtctcgcaaactcaacaggccaaccgctacattctcacaatggcag
acttccaaccaaattgtggaactattaaatacaaacgttgatgccgatcgtatagcgcgt
tcgttagcggcacaaatggcttccgatattcgggagttggagaatggtccagaggcttct
gggtatcttattaagcttggattagttcaactactcgatagatgcctcaaggctatccca
aacaagcctacggtagctcatgtccttcttggatttagatgtgttggaagttcccttgat
gtggcaccaggtagcctttttgacaacggcctttcattgctacatgctatcagtgatttt
gtcaggacctatccggatggcaatcaaggcatgataacatcatggatggtgcatttaaag
cgattggcattccaggtactgcaatatctttggacttcggcgctctcttcgccacttatc
ctgcctcaacttcgtgcaaatcggctgctcgcaaacattctcatatctcaacccgtaatc
ggccctgacttgctttgggatgagttccgaataacggtgcccgaattctggtttacagaa
tctgccgtggcactttcggagttccttgtctatcgcagcattatctttgactatgcaaca
accgaaataagagctgtgtttaataaaagctctccttccttccagaaagatattttatca
acgttgcttggcgcttcagtagctgaagatgggcaaacaatctcccacccttcaattttt
gatttgtttgactttgcggacctggacatcgattgggcatacgctttccctgatctaaaa
ttttttagggatgtggacgtgagtttatgcaccacgcctcagcaagatggccatccagtt
ttatatgatctcccaagcgtggaatcccttctccagcttgcaaaagaccatcttgttagt
gctggccaagtcaacgctcaggaagaagatcaaatctcgtcggaacgcgataagcttctc
ctcttcctccgtgctacgaatcaaagctgccaagtccgctataatcgtctcgtcgcttta
agatcttgggtggagctggttatcaccgttttgattacttgtgacatggaacctgctcgt
atggtgacacttatcttacacactcttcaggccattcttcccaaacttgagagttctttt
gctgggaacgcagcagaagctattgaattagctcgtctggcggaaactctggttgaaaag
ctagacaccgtttcgacaaacagcactgaagatgtcatagatgagcgcctacatcacctt
ttccaggcttgtattcgtggcatccccaacatattagaagagacggtcttgagggaaact
ttttatcacatttgctccagatatcttacacgaattactcagagaagtacggccaaagct
cgtttcggaccccgggcccagcaagttatcaaatcaacaggttcgggcctagtcgatact
atttgcgacgacgcctattccggtgatgaaggttgtagagtgtcggccctgatattactg
aatcttctttctgttctcgatgaacagcagtcatcttctattctcgtgaccttgatctct
cagtctaattatctttctatgttccttggtgtcatcagagccatggcgtcagaattccga
aacacccaagctgcacagacggcccaattgctactattttacgaagctctattgtcactc
ctccaacaactgtcgcaaacgaaaatgggtgctattcgccttcttgatgcaggtctattt
caagcagtcaaggaatcccagatttttgcggctgaccccgatatcggtttagacatcgat
aatcccgatgctctccgtaaatattatgacctccttctatctgtgcttcgagtcattgtc
tctaccgttttcacacggggcttacacaacaatcagattgtcgagcaaactagaaatttc
ctgtctgaaaaccggcagagtatggttggaattttcaaacgctatgctaaaattggaggg
cttgaaggtgtcggaacacaggagtctctagaagagcttgtcaaatcatacgttgcattg
attgccgctgttgacttccttgagtttgaggaggagcaatcggagcagccagctggacga
aagttattctcatga

DBGET integrated database retrieval system