KEGG   Coccidioides posadasii: CPC735_017410Help
Entry
CPC735_017410     CDS       T01332                                 

Definition
(RefSeq) triosephosphate isomerase, putative
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00010  Glycolysis / Gluconeogenesis
cpw00051  Fructose and mannose metabolism
cpw00562  Inositol phosphate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01130  Biosynthesis of antibiotics
cpw01200  Carbon metabolism
cpw01230  Biosynthesis of amino acids
Module
cpw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cpw_M00002  Glycolysis, core module involving three-carbon compounds
cpw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_017410
   00051 Fructose and mannose metabolism
    CPC735_017410
   00562 Inositol phosphate metabolism
    CPC735_017410
Enzymes [BR:cpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPC735_017410
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPC735_017410
  Exosomal proteins of bladder cancer cells
   CPC735_017410
  Exosomal proteins of melanoma cells
   CPC735_017410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 9692755
NCBI-ProteinID: XP_003067284
UniProt: C5PDH8
Position
Unknown
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGTQKSITDIITNLNSANLDPNTEVVISPPSLYLILSRSLADPKIGV
ASQNVFDKPMGAYTGELSVEQLQDCGISWTLVGHSERRVILKEDDDFAARKTKSAIDGGL
SVILCVGETLEEREADKTVDVVTRQLGAVASRLSAQDWSKLVVAYEPVWAIGTGKVATTE
QAQEVHAAVRKYIAESVSPSVAENLRIIYGGSVNEKNCKELAKQADVDGFLVGGASLKPA
FVDIVNARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaaattcttcgttggcggtaacttcaagatgaatgggactcaaaagtccatc
accgatatcatcaccaatcttaacagcgccaatctcgatcccaacaccgaagtcgtcatc
tcccccccttccctctacctcatcctctcccgtagccttgccgatcccaagatcggcgtt
gcctctcagaatgtcttcgataagcccatgggagcgtacactggtgaattgagcgtggaa
caattgcaggactgcggtatttcctggacattggttggacacagtgagcggagagttatc
ttgaaggaagatgacgactttgctgcacgcaagaccaagtctgctattgatggcggattg
agcgttattctctgcgtcggagagactcttgaggagcgtgaggcggacaagactgtcgat
gttgtgaccagacaactaggcgcagttgcttccagactcagcgcccaggactggtctaag
ttggttgttgcatacgagcccgtctgggccattggaaccggcaaggttgccacaaccgag
caggcccaagaggtccatgctgcagtccgcaagtacatcgcggagagcgtttcgcccagt
gttgctgagaacctccgtatcatctatggcggcagtgtcaatgagaagaattgcaaggaa
cttgctaaacaagcggatgttgatggattcctggtcggtggagctagtttgaagccagca
ttcgttgacattgtcaatgctcgtctctaa

DBGET integrated database retrieval system