KEGG   Coccidioides posadasii: CPC735_017620Help
Entry
CPC735_017620     CDS       T01332                                 

Definition
Longevity-assurance family protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPC735_017620
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CPC735_017620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MALAASDPPGLYKGRPPRSFSETNVAPHSKRRRARSVFRCWENFCLKHTWVIPLVLLTVI
LSAYAVNPNDSNPIHQLIFLSYPLPPETPDGPVMYGKGPADMAFVVFYTIVLSFTREFLM
QRMIKPLARRCGIKGKAKTSRFMEQFYTAVYFAIFGPYGLYVMSRTKIWYFNTTAMFEGF
PHKTHTADFKAYYLLEASYWAQQAIVLVLQLEKPRKDFKELVGHHIVTLALIALSYRFHF
TYIGLAVYITHDVSDFFLATSKTLNYLDSAIMGPYFAMFIAIWIYMRHYLNLRIIWAVLT
EFRTVGPFELNWETQQYKCWISQYITFALLSALQAINLFWLFLILRIAKRYLLNNIKQDE
RSDNEEEEEEVEDTPHNDKTNNGSTTVPTILLNGNSPTSVRRRNADKENEVSNGVTNGRA
TGSTAHSHAESSTPTMNGKKQK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgccgcttcggatccccctgggttgtacaagggtcgacctccgcgatcattt
tctgaaacaaatgtcgctccccactcgaagcggcgtcgtgcgcgctcggtgtttcgctgc
tgggagaacttctgcctcaagcacacatgggtcatacctctcgtcctgttaacagttatc
ctctccgcctacgctgtgaatccaaatgattccaatcccatacaccagctcatcttcctc
tcctatccacttcctcctgaaacacccgatggaccggtgatgtatgggaagggccctgcc
gacatggcctttgtggtgttttacacaatcgtgctctccttcacacgtgaatttttgatg
cagaggatgatcaaaccgctggcgcgtcgctgtggaataaaggggaaggcgaaaacctcc
cgtttcatggaacagttctacaccgctgtttactttgccatcttcgggccctacggtcta
tatgtcatgagtcgcacgaagatatggtacttcaatacgacggcgatgttcgaaggcttc
ccccacaagacgcacactgccgatttcaaggcgtattacttgcttgaggcaagctactgg
gcccagcaggccatcgttttggtcttgcagctggagaaacctaggaaggatttcaaagag
cttgtgggacatcacatcgtcacactggcgttgattgcgctcagctatcgtttccatttc
acttatatcggcctggctgtctatattacacatgatgtgtcggacttcttccttgcgact
tccaaaacactaaattatttggattctgcaatcatgggcccttactttgcgatgtttatt
gccatctggatttacatgagacattacctgaatctccgcattatctgggctgtcttaacg
gaatttcgaactgtcgggcccttcgagctcaattgggaaacacagcaatacaaatgctgg
atcagtcagtatattacatttgcacttttgagcgcgctgcaggccataaacttgttctgg
ctcttccttatccttcgaatcgcaaagcgatatcttctcaacaacatcaaacaggatgaa
cggagcgataatgaagaggaagaggaggaagtcgaagatacacctcacaacgacaaaact
aataatggttcaacaaccgtcccgacgatattacttaacggaaacagcccgacatcagtt
aggagaagaaatgctgataaggagaatgaagtttctaacggtgttaccaatggccgtgcg
actggctctacggcacattcacatgctgaatcctcgacacccaccatgaatggcaagaag
caaaaatga

DBGET integrated database retrieval system