KEGG   Coccidioides posadasii: CPC735_019180Help
Entry
CPC735_019180     CDS       T01332                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
cpw  Coccidioides posadasii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cpw04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1680 aa AA seqDB search
MAPLPIKFTELLQLTNLDIVPASIGFNSCTLESDSFVCVRQKLPESDKTQVIIINLKNNN
EVVRRPINADNAIMHWNRNIIALKAQGRTVQVFDLQAKEKLKSAVLTEDVVYWKWFSETS
LGLVTEAAVYHWNVFDPSQHAPIKMFDRIANLNGCQIISYKVNEDQKWMAVVGISQQQGR
IVGTMQLHSVERGISQHIEGHAAAFASISVEGSPLPHKLFTFAVRTQTGAKLQIAEIDHQ
EPNPKFAKKAVEIYFPPEATNDFPVAMQVSKKYDIVYLVTKFGFIHLYDLETGTCIFMNR
ISSETIFVTTPDSESTGLVGVNRKGQVLSVSVDENTIIPYLLDNPANTSLAVKLAAKGGL
PGADNLLQRQFETLLSQQNYIEAAKVAANSPRGFLRTPETINRLKSAPQSAQGMSVILQY
FGMLLDKGSLNKYESIELVRPVMQQSRKHLLEKWLSEDKLECSEELGDIVRPYDVGLALG
IYLKANVPHKVVAGFAETGQFDKIIAYSKQVGFQPDYVQLLQHIVRVNPEKCAEFAGQLV
SEESGAVVDLDRVVDVFISQNMIQQATAFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNEMFTHYDKARVSQLCEGAGLYQRALENTEDPAVIMRNIVRTDKLNPDWLSNYFG
RLSVEQSLECMNEMLKVNLRQNLQAVVQLATKYSDLLGATNLINLLEKYRTAEGLYYYLG
SIVNLSEDPDVHFKYIEAATKMGQMTEVERICRESNYYNAEKVKNFLKEARLTEQLPLII
VCDRFNFIHDLVLYLYQNQQYNSIEVYVQRVNPSRTPAVVGGLLDVDCDEGIIKNLLSTV
DPSSIPIDELVSEVETRNRLKILLPFLESTLATGNQQQAVYNALAKIYIDSNNNPEKFLK
ENDLYDTLVVGKYCEKRDPNLAYVAYRKGQNDLELINITNENSMYRAQARYLLERADPEI
WAFVLNSNNIHRRSLVDQVIATAVPESAEPDKVSIAVKAFLDADLPTELIELLEKIILEP
SPFSDNSSLQNLLMLTAAKADKGRLMDYIHQLTEFNADEIASMCLSVGLYEEAFEIYKKV
DNHISATNVLVDYIVSIDRAQEYAERVELPEVWSKVAKAQLDGLRVSDAIASYIRAGDPS
NYNEVIETATHAGKDEDLVEFLKMARKTLREPAVDTALALSYARLNQLPELEDFLRGVNV
ADIEASGDKAYEEGYHEAAKIFFTSISNWAKLATTLVHLEDYQAAVECARKGNSVKVWKQ
VNEACVAKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIALLEAGLGLERAHMG
MFTELGIALSRYHPDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLYCHYDEWDNAA
LAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTPRIDVNRV
VRMFEKSDNIPLIKPFLLNVQPQNKKAVNNAINDLLIEEEDYKTLRDSVENHDNYDPVEL
AQRLEKHDLVFFRQIAASIYRKNKRWEKSISLSKQDKLFKDAIETAAISGKTEVVEDLLR
YFVDIGSRECYVGMLYACYDLIRPDVVLEMSWRHGLNDFTMPYMINMLSQQVRTIEMLKK
DNEERKAKEAAQQKEEDNTPVLGGTRLMLTQGPASPAAHAMPLGGQTNGITPQMTGFRPF
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcttccgattaaatttacggaactacttcagttgacgaacctcgatattgtg
cccgcatctatcggattcaattcatgtacccttgaatccgattcattcgtgtgcgttcgt
caaaagttacccgaaagtgacaaaacgcaagtcattatcatcaacctcaagaataataat
gaagtcgttcgtcggcccatcaacgccgataatgctatcatgcattggaaccgaaacatc
atcgccctcaaggcccagggtagaaccgttcaagtctttgacctccaggcgaaggagaaa
ttgaaatccgccgtgctcaccgaggatgttgtgtattggaaatggttcagcgagacgagt
ttgggcctggtaacagaggctgcggtttaccattggaacgtcttcgatccgtctcagcat
gcgcctataaagatgtttgaccgcatcgctaatctaaacggatgccaaatcatcagctac
aaagtcaacgaagatcagaaatggatggctgtcgtcggtatcagccagcagcaaggacgc
attgttggaacgatgcagcttcactccgtcgagcgtggtatttcacagcacattgaaggc
catgccgccgctttcgcatccatctctgtcgaaggctcccccttgccgcacaagcttttc
acgtttgctgttcgcacccaaaccggagcaaaactgcagatcgcggagatcgatcaccaa
gaacccaatccgaagtttgcgaagaaggccgtggagatctacttcccaccagaggcgacc
aatgatttcccggtcgcgatgcaggtttcgaagaaatatgacattgtatatctcgtcaca
aaattcggcttcattcatctatatgacctagaaaccggcacgtgcattttcatgaaccgc
atctcaagcgagacgatcttcgttacgactccagactcggaatccacgggtctggtcggg
gtcaaccgcaagggtcaagtcctatccgtcagcgttgatgagaacaccatcattccttac
ctcctcgataatccagccaacacatcgcttgctgttaagctggctgctaagggaggcctt
ccaggtgcagataatcttctccagagacaatttgagacgctcctttcccagcagaactat
atagaggctgcaaaggttgcggcaaactcaccacgtggcttcctccgtaccccggagacc
attaaccgactcaagagcgctcctcagagtgcacaaggaatgtccgtcattctccagtat
ttcggcatgctgttggacaagggttcgttaaacaagtatgaaagtattgaattggttcga
cccgttatgcagcagagtcgaaagcatctgctcgaaaaatggcttagtgaggacaagctt
gagtgttctgaggagctgggtgatattgtgcgaccatacgatgttggccttgctttgggg
atctatttgaaggcaaacgtcccccacaaagttgtcgctgggtttgcggaaaccggacag
tttgacaagattattgcttactccaagcaagttggcttccagcctgattatgtccaactt
ctccagcacatcgttcgcgttaaccccgaaaagtgtgccgagttcgctggtcaacttgtt
agcgaggagagtggcgccgtcgtcgatctcgatcgtgtggttgatgtttttatatctcaa
aatatgatccaacaagccactgctttcttgctagatgccctcaaggacaacaagccggaa
catgggcacctccagactcgcctcctggaaatgaatctcgtaaatgctcctcaggttgcg
gatgctattctcggaaatgaaatgttcacccattacgacaaggccagggtctcacaactc
tgcgaaggtgctgggttgtaccagcgagctttggagaacaccgaggatcctgcggtcatc
atgcgcaatatcgtccggaccgataaattaaatcccgactggctgtccaattacttcggg
cgcttgtcagttgaacagtccttggagtgcatgaacgaaatgctcaaagtgaacctgcgg
cagaatcttcaagccgtggttcagttggctaccaagtactcggacctgttgggcgcgacc
aacttgatcaatctcctcgagaaataccgaacggcagaaggcctatactactaccttggc
agcatcgtcaatttgagcgaagatcctgacgtgcacttcaagtatatcgaagccgctacc
aagatgggccagatgacagaggttgagcgaatctgccgtgagagcaactactataatgct
gagaaagtcaagaacttcctcaaggaggcccgtctcaccgagcagcttcctctaattatt
gtctgtgacagattcaatttcatccacgatttggtcctttacctgtaccagaatcagcag
tacaattccattgaggtatatgttcagagagtcaatccgtctcgaactccagctgttgtg
ggaggacttctcgacgtcgattgcgatgagggcattatcaagaatctcctttcaaccgtg
gatccttcgtctattccgatcgatgagcttgtctccgaggtagagacccggaaccgcttg
aagattctccttccattcctggagagcactcttgctaccggaaaccagcaacaggcagta
tataacgcccttgccaagatttacattgatagcaacaataatcccgagaagttcttgaag
gagaatgatctctacgatacattggttgtcggtaaatattgcgagaagcgtgatccaaac
ttggcttacgttgcgtaccgaaagggccaaaatgacttggagctcatcaacatcaccaat
gagaattcgatgtaccgagcccaggcaagatatcttcttgaacgcgccgaccctgagatt
tgggccttcgtattaaacagcaataacatccaccgccgctctctggtcgatcaagtgatt
gccaccgccgtgccagaatcagccgagccagacaaggtttccattgccgttaaagctttc
ctcgatgccgatttgcctacagagctgatcgagctcttggagaagattatcctagaacca
tctccattcagcgacaacagcagtctgcagaatctcttgatgcttacggctgccaaggcg
gacaagggccggttgatggactacatccaccagctgacagagttcaatgccgacgaaatc
gcaagcatgtgtctgtctgtcggtctgtatgaagaagcgttcgagatctacaagaaggtt
gataaccacatctccgccacaaacgtgcttgtcgactatattgtcagcattgaccgcgcg
caagagtacgctgaacgtgttgagctcccagaagtctggagcaaagtagcaaaggctcag
ctggatggccttcgcgtttccgatgccattgcttcgtatatccgggctggagacccatcg
aactacaatgaagtcattgagaccgccactcacgccggcaaggacgaggacctcgtcgaa
ttcttgaagatggccagaaagactctccgtgagccggctgtcgacactgcgctcgccctc
tcctatgccagacttaaccagcttcctgagcttgaagacttccttcgcggagttaacgtt
gcagacatcgaagcttctggtgacaaggcctacgaagaagggtatcacgaagccgccaag
atcttcttcactagtatctccaactgggcaaaactcgccaccaccctcgtccatctcgag
gattaccaggctgcggtcgaatgcgctcgaaaaggaaacagcgtcaaggtctggaagcag
gttaacgaggcctgtgttgccaagaaagagttccggctggcccagatctgcggtctcaac
ctcatcgtccacgcggaggagttgcaggacctggtgcgccagtatgagcgtaacggatac
ttcgacgagctcatcgctttgctcgaggccggtctaggcttagagagggcacacatgggc
atgttcaccgagctgggcatcgccctgtcgagatatcacccggacagagtgatggagcac
ctgaagcttttctggacacgcatcaatatccccaagatgatccgagcctgcgaggaagcg
aatctctggcccgagctggtattcttgtactgccattacgacgagtgggataacgctgcc
ttggcgatgatggagcgggcggcggatgcctgggaacaccactccttcaaggacatcatt
gtgaaggtggcgaacctggagatctactaccgggcactaaacttctacctccaggaacag
ccgctgctgctgacggacctgctgcaagttcttacgccacggatcgatgtgaatcgggtg
gtgcgcatgttcgagaagtccgacaacatcccgctgatcaagccgttcctgctcaacgtc
cagccccagaacaagaaggcggtcaacaacgcgatcaacgatctgctgatcgaggaagag
gactacaagacgctgcgcgactctgttgagaaccacgacaactacgacccggttgagctg
gcgcagaggctcgagaagcacgacctggtgttcttccgacagatcgcggcgagcatctac
cgcaagaacaagcggtgggagaagtcgatctcgctgtcgaagcaggacaagctcttcaag
gatgcgatcgagacagcggcaatttcgggcaagaccgaggttgtggaggaccttttacgt
tatttcgtggacatcggcagccgcgagtgctatgtgggcatgctgtacgcgtgctacgat
ctgatccggccggacgtggtgcttgagatgtcgtggcgacacgggctgaacgacttcacg
atgccgtacatgatcaacatgctgagccagcaggtgcggacgatcgagatgctgaagaag
gacaacgaggagcgcaaggcgaaggaggcggcgcagcagaaggaggaggacaacacgccg
gtgcttggggggacgagactgatgctgacgcagggaccggccagcccagcagcgcacgcg
atgccgcttggagggcagacaaatgggatcacgcctcagatgacgggcttccggccattc
taa

DBGET integrated database retrieval system