KEGG   Coccidioides posadasii: CPC735_021100Help
Entry
CPC735_021100     CDS       T01332                                 

Definition
eukaryotic translation initiation factor 4E-1, putative
Orthology
K03259  
translation initiation factor 4E
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CPC735_021100
Translation factors [BR:cpw03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CPC735_021100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MAAAVAGNVVAPVADENIPPNGVESEIKKDEEITVFHDPNNFNVKHPLMNEWTLWFTKPP
SGKGDNWNDLLKEVVTFNSVEEFWGVYNNITPTSELGLKADYHLFKKGVRPEWEDQQNKH
GGKWSFQFKDKRSVPIDELWLHSQLAAIGETLENDGDNEVMGVVVNVRKGFYRIGLWTRT
VGKLIPGSDGRSAEKSQEILKAIGRRFKEVLRLKDTDQLEFSGHTDSAQSGSTRAKAKFV
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcagtcgcaggaaatgttgttgctcctgtagcagatgagaacatccctcca
aatggagtggaatctgagattaagaaggatgaagagatcacagttttccacgacccaaat
aatttcaatgtgaagcatccccttatgaatgagtggacactctggttcaccaaaccacca
agtggcaagggtgataactggaacgatcttttgaaggaggttgtaacatttaactctgtc
gaggaattctggggagtctataacaacataacaccaacctccgaacttggtctaaaagcc
gattaccaccttttcaagaagggcgtccgaccagaatgggaggaccagcagaacaagcat
ggcggcaaatggtcttttcagttcaaagataagcgcagtgtccctatcgatgaactttgg
ctccactctcaacttgccgctattggcgagacgcttgagaacgatggcgacaacgaagtt
atgggtgttgtggtgaatgtgcgcaaaggcttctaccgtattggtctttggacaagaact
gttggcaagttaattccgggttctgatggtcgttccgctgagaagagtcaagaaattttg
aaggcaattggacgacgattcaaggaggtattgagattgaaagacacagatcagttggaa
ttttctggccataccgatagcgcccaatcgggaagtacgagagccaaagcgaagtttgtg
gtttga

DBGET integrated database retrieval system