KEGG   Coccidioides posadasii: CPC735_021820Help
Entry
CPC735_021820     CDS       T01332                                 

Definition
Acyl-CoA desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cpw  Coccidioides posadasii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CPC735_021820
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CPC735_021820
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CPC735_021820
Lipid biosynthesis proteins [BR:cpw01004]
 Desaturase
  First
   CPC735_021820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 462 aa AA seqDB search
MAAPAVAADASKARPAGADIKKPHITETPMTWSNWHKHVNWLNVTLILLIPLYGCVQAFW
VPLQLKTAIWAIAYYYMTGIGITAGYHRLWAHCSYSATLPLRIYLAAVGGGAVEGSVRWW
ARDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMIMKQNPRRIGRTDITDLNEDPVVVWQHR
NYLKVVITMGLIVPMLVSGLGWGDWWGGFIYAGILRIFFVQQATFCVNSLAHYLGEQPFD
DRNSPRDHVMTALITMGEGYHNFHHEFPSDYRNALEWYQYDPTKWIIWVWKQVGLAYDLK
QFRANEIEKGRLQQLQKKIDQRRAKLDWGIPLEQLPVMEWDEYVEQAKNGRGLIAVAGVV
HDVTDFIKDHPGGKAMINSGIGKDATAMFNGGIYNHSNAAHNLLSTMRVGVIRGGCEVEI
WKRAQQENKDVESVRDANGKRIIRAGEQVTKLPEPVPSAGAA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccagccgtggctgcagatgcctccaaggctcgccctgccggtgctgatatc
aagaagcctcatatcacagagacgccaatgacctggtcgaactggcacaagcatgttaac
tggctgaacgtcacgctgatccttctcattcctctgtatggttgtgttcaagcgttctgg
gttcccctccagctcaagaccgctatctgggctattgcgtattattatatgaccggtatt
ggtatcaccgctggttaccatcgtctttgggctcactgctcgtattctgccacccttccc
ttgagaatctacctggctgccgttggaggaggtgccgtcgaaggatcggtcagatggtgg
gctcgtgatcaccgtgcccaccaccgctatacggataccgacaaggacccttactccgtc
cgcaagggtctcctgtactcccacattggctggatgatcatgaagcagaatccaagacgt
attggccgcactgacatcaccgatctcaacgaggacccagtcgtcgtctggcagcacaga
aactacctcaaggtcgtcatcacaatggggttgattgttcctatgcttgtcagtggactc
ggatggggagactggtggggtggtttcatctatgctggtatccttcgaatcttctttgtc
cagcaggctaccttctgcgtcaactccttggcccattacctgggagaacagcccttcgat
gaccgcaactctccccgtgaccacgttatgactgccttgatcaccatgggtgaaggttat
cacaacttccaccacgaattcccttctgactaccgcaacgccctcgaatggtatcagtat
gacccaaccaaatggatcatctgggtttggaagcaagtcggactcgcatacgacttgaag
cagttccgcgccaacgaaatcgagaagggacgcctccagcagctccagaagaagatcgac
caaagacgtgctaaactcgactggggtattcctcttgaacagttgccagtcatggaatgg
gacgagtacgtcgagcaggccaagaatggtcgtggccttattgccgtcgcaggagtcgtc
catgacgttaccgatttcatcaaggatcacccaggtggcaaggccatgatcaactccggt
attggcaaggacgcaaccgccatgttcaacggtggtatttacaatcactccaacgccgcc
cacaacctcctgtcaacgatgcgtgtcggtgttatccgaggtggctgcgaagtcgagatc
tggaagagagcccagcaggaaaataaggatgtcgaatccgtccgtgacgctaatggaaag
agaatcattcgtgcgggcgagcaagtgaccaagctccccgagccagtcccaagcgccggc
gctgcctaa

DBGET integrated database retrieval system