KEGG   Coccidioides posadasii: CPC735_021820Help
Entry
CPC735_021820     CDS       T01332                                 

Definition
Acyl-CoA desaturase, putative (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cpw  Coccidioides posadasii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cpw01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cpw01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 462 aa AA seqDB search
MAAPAVAADASKARPAGADIKKPHITETPMTWSNWHKHVNWLNVTLILLIPLYGCVQAFW
VPLQLKTAIWAIAYYYMTGIGITAGYHRLWAHCSYSATLPLRIYLAAVGGGAVEGSVRWW
ARDHRAHHRYTDTDKDPYSVRKGLLYSHIGWMIMKQNPRRIGRTDITDLNEDPVVVWQHR
NYLKVVITMGLIVPMLVSGLGWGDWWGGFIYAGILRIFFVQQATFCVNSLAHYLGEQPFD
DRNSPRDHVMTALITMGEGYHNFHHEFPSDYRNALEWYQYDPTKWIIWVWKQVGLAYDLK
QFRANEIEKGRLQQLQKKIDQRRAKLDWGIPLEQLPVMEWDEYVEQAKNGRGLIAVAGVV
HDVTDFIKDHPGGKAMINSGIGKDATAMFNGGIYNHSNAAHNLLSTMRVGVIRGGCEVEI
WKRAQQENKDVESVRDANGKRIIRAGEQVTKLPEPVPSAGAA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccagccgtggctgcagatgcctccaaggctcgccctgccggtgctgatatc
aagaagcctcatatcacagagacgccaatgacctggtcgaactggcacaagcatgttaac
tggctgaacgtcacgctgatccttctcattcctctgtatggttgtgttcaagcgttctgg
gttcccctccagctcaagaccgctatctgggctattgcgtattattatatgaccggtatt
ggtatcaccgctggttaccatcgtctttgggctcactgctcgtattctgccacccttccc
ttgagaatctacctggctgccgttggaggaggtgccgtcgaaggatcggtcagatggtgg
gctcgtgatcaccgtgcccaccaccgctatacggataccgacaaggacccttactccgtc
cgcaagggtctcctgtactcccacattggctggatgatcatgaagcagaatccaagacgt
attggccgcactgacatcaccgatctcaacgaggacccagtcgtcgtctggcagcacaga
aactacctcaaggtcgtcatcacaatggggttgattgttcctatgcttgtcagtggactc
ggatggggagactggtggggtggtttcatctatgctggtatccttcgaatcttctttgtc
cagcaggctaccttctgcgtcaactccttggcccattacctgggagaacagcccttcgat
gaccgcaactctccccgtgaccacgttatgactgccttgatcaccatgggtgaaggttat
cacaacttccaccacgaattcccttctgactaccgcaacgccctcgaatggtatcagtat
gacccaaccaaatggatcatctgggtttggaagcaagtcggactcgcatacgacttgaag
cagttccgcgccaacgaaatcgagaagggacgcctccagcagctccagaagaagatcgac
caaagacgtgctaaactcgactggggtattcctcttgaacagttgccagtcatggaatgg
gacgagtacgtcgagcaggccaagaatggtcgtggccttattgccgtcgcaggagtcgtc
catgacgttaccgatttcatcaaggatcacccaggtggcaaggccatgatcaactccggt
attggcaaggacgcaaccgccatgttcaacggtggtatttacaatcactccaacgccgcc
cacaacctcctgtcaacgatgcgtgtcggtgttatccgaggtggctgcgaagtcgagatc
tggaagagagcccagcaggaaaataaggatgtcgaatccgtccgtgacgctaatggaaag
agaatcattcgtgcgggcgagcaagtgaccaagctccccgagccagtcccaagcgccggc
gctgcctaa

DBGET integrated database retrieval system