KEGG   Coccidioides posadasii: CPC735_022250Help
Entry
CPC735_022250     CDS       T01332                                 

Definition
peroxidase, putative (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CPC735_022250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MASAARTLTRAFARATPATSSARSSVTRSSLRFSAPAYTFRASSRRGYSSGAEGGKSSSG
LIWGLAAVAAGGAGAFYYLNGDHLSSNSAKPTIISDPTKEDFQKVYDEIARLLVEKDDYD
DGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKKK
FPWISYSDLWTLAGSCAIQELGGPDIPWRPGRKDADMTACTPDGRLPDASKDQKHIRAIF
GRMGFDDREMVALCGAHALGRAHSDRSGYDGPWDFSPTVFTNEFFKLLLDEKWVQKKWNG
PKQFTDNTTKTLMMLPTDMALIKDKEFKKHVDRYAKDSDVFFKEFSDVFVKLLELGVPFT
SKAEDRYVFKRSE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgcgcgaactctcaccagagcttttgctcgagccactccagcaacctct
tctgctcgatcttcagtcacccgtagctcacttcgcttctctgctcccgcctacactttc
cgcgcgtcgtctcgcaggggctactcctccggcgctgaaggtggaaagtcgtcctctggc
ctcatctggggtcttgcagccgttgccgctggtggtgccggtgctttctactacttgaac
ggtgaccacctgtcctcgaattcggcgaaacctactatcatctccgacccaaccaaggag
gacttccagaaggtttatgatgaaattgcaagacttcttgtagagaaggacgattatgat
gatggaagctacggacctgtccttgttcgtctcgcctggcacgccagtggtacctacgat
aaggaaactgggactggaggaagcaatggcgctaccatgcgcttcgccccagagtctgac
cacggtgccaatgctggattgaaggctgctagagatttcctcgagccagtaaagaagaaa
ttcccttggatttcttactccgatctctggacccttgctggttcttgtgccatccaggag
ttgggaggacctgacatcccatggcgccccggccgcaaggacgctgatatgactgcctgc
acacctgatggtcgtcttccagatgcctccaaggatcagaagcacatcagagctatcttc
ggtcgtatgggtttcgatgatcgcgagatggtcgctctttgcggcgctcacgctctcggc
cgtgctcacagcgaccgatccggctatgatggaccatgggacttcagccctactgttttc
accaatgaattcttcaagttgcttttggacgagaaatgggtccagaaaaagtggaacggc
cctaaacagttcaccgacaacaccaccaagaccttgatgatgcttccaacggatatggct
ttgattaaggataaagaattcaagaaacacgtcgaccgatacgccaaggatagcgatgtc
ttcttcaaggagttctccgatgtattcgtcaagctccttgagctgggcgtgcctttcacc
tccaaggctgaagaccgctacgtcttcaagagaagcgagtaa

DBGET integrated database retrieval system