KEGG   Coccidioides posadasii: CPC735_022450Help
Entry
CPC735_022450     CDS       T01332                                 

Definition
Aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cpw  Coccidioides posadasii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_022450
Enzymes [BR:cpw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CPC735_022450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MDRSNKPAAIPVTSSLPQPSVTVQDGRVQASLASGESVTVHLFGATVTSWKLANGHELLF
LSEKAHLDGSKPIRGGIPLVFPVFGPPPQNHATSALPQHGFVRNSSWELLGKSTSESESG
ASVKLDFGLSNSMLSDKFKGDWPYEFGLVYSVTLSKRSLETSLRVQNEGLKSFEFQTLLH
SYFKVEDISKIRVQNLQSKTYVDKVRNAEAFTESSPALAVEGEVDRVYQSLDPKVPIVIA
SESDKPIFSITRESLNDVVVWNPWIEKAKGMADFAPDEAYKNMICVEAGSVVGWQTLEPG
DTWEGGQTIECKL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttcaaacaagcccgctgccattccagtcacctcctctctcccgcaaccgtcg
gtcaccgttcaggacgggagggtacaggcctcgctggcttcgggggaatcagtcacagtt
catctctttggagccacagtcacctcatggaagctggccaacggacacgagctactgttc
ctgagtgaaaaggcccatctggacggctcaaaacctattcgtggtggaattccactggtc
ttccccgtgtttggacctcctccgcagaatcatgccacgtccgcccttccacaacacggc
ttcgtgcgtaattcctcatgggaattgcttggtaaatctacatccgagtcagagagcgga
gcaagcgttaagcttgactttggcctctcaaactctatgcttagcgacaagttcaaaggc
gactggccctatgaatttggcttggtctacagcgttactttgagcaaacgaagcctggag
acctcgttacgggtacagaacgagggcttgaaatcgtttgaatttcagactctgctgcat
tcttactttaaggtcgaggatatctccaaaattcgagtccagaaccttcagtcgaaaaca
tacgttgataaagtccggaacgctgaggctttcacagaatcatccccggcactcgcagtt
gaaggggaggtagaccgggtctatcagtctctggaccccaaagtgccaatagttatagcg
tcggaatctgacaagccaatcttctctattacccgtgagtcgctgaatgacgtcgttgtg
tggaacccgtggattgaaaaggccaagggaatggccgattttgctcctgacgaggcatat
aaaaatatgatctgtgttgaggcgggatcggtagtcggttggcagacccttgagccgggt
gatacctgggaaggtggacagacaattgagtgcaaattatag

DBGET integrated database retrieval system