KEGG   Coccidioides posadasii: CPC735_023980Help
Entry
CPC735_023980     CDS       T01332                                 

Definition
glutathione peroxidase, putative
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cpw  Coccidioides posadasii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CPC735_023980
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CPC735_023980
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CPC735_023980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 176 aa AA seqDB search
MSSATSFFDFATPDKKGEPFPLSSLQGKVILVVNTASKCGFTPQLQGLEALYKKISADHP
DKFTVLGFPCNQFGSQDPGTNDEIQSFCQVNYGVTFPILGKVDVNGDKAAPVFEWMKKEM
PGLMGLKRVKWNFEKFLISADGKVVGRWTSITKPESLEAPILKEIEKMEKGGRTSL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagcaaccagcttcttcgactttgcgacccccgacaagaagggcgaacctttc
cccctctcctccctccaaggcaaggtaatccttgtcgtcaataccgcctccaaatgcggt
ttcaccccgcaacttcaaggcctagaggctctctacaagaagatctccgccgaccatcca
gacaaattcactgttctcggtttcccctgcaaccaattcggttctcaggaccctggcacc
aacgatgaaatccagtccttctgccaggtcaattacggcgtgacgttccccattctcggc
aaagtcgatgtcaacggcgataaagcggcaccggtatttgagtggatgaagaaggaaatg
cctggccttatgggcctgaagagggtcaagtggaactttgaaaagttcttgatcagtgca
gacgggaaggtcgttggaaggtggacgagtattacaaagccagagtccttggaggcgcca
atcttaaaggagatcgaaaagatggagaaaggaggaaggacttcgctgtag

DBGET integrated database retrieval system