KEGG   Coccidioides posadasii: CPC735_026170Help
Entry
CPC735_026170     CDS       T01332                                 

Definition
histone acetyltransferase, ELP3 family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CPC735_026170
Transfer RNA biogenesis [BR:cpw03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CPC735_026170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 580 aa AA seqDB search
MATETLTLRPATQQRKVPKAAKLPPENERYMRACSDIANALIQDYEAQRDSTKPKKDINL
NKLRGQISKKHSLSTQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHR
CPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSL
GHSVDKVEYIIMGGTFMSLPEDYREEFIAQLHNALSGYQTNNVDEAVQAGEMSNIKCVGI
TIETRPDYCLDTHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAG
FKVVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYK
NYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALGRMKDFGTTC
RDVRTREVGINEVKNKIRPSQIELIRRDYVANDGWETFLAYEDPKQDILIGLLRLRKCSA
KYTFRPELTGQQTSLVRELHVYGSAVPVHGRDPRKFQHRGFGTLLMEEAERIAREEHGSR
KISVISGVGVRSYYAKLGYWLDGPYMSKMLDPVEPEDAEE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagactctgactctacgtcccgccacccagcagcgcaaagtgcccaaggct
gcgaagctacctcccgaaaatgagcgctatatgagagcctgttcggacatagcgaatgcg
ctgattcaggactatgaggctcaaagggactcaacgaagcccaaaaaagatatcaacctg
aacaagctgcggggtcaaatttcgaagaagcacagcttgagcactcagcctcctctaaca
gcaatcattgcagcagtcccagagcattataagaagtatattttgccgaagctgatcgca
aagccgataaggacatcttccggtattgcggttgttgctgttatgtgcaagcctcatcga
tgtcctcatattgcatacactggaaacatttgcgtgtattgtccaggcggtcctgattcc
gactttgaatactccacccagtcctataccggatacgagccgacgtcaatgcgagctatc
cgcgcccgctatgaccctttcgagcaagcgcgagggcgggtggaccagatcaaatccctt
ggccacagcgtggataaggtggagtatattatcatgggtggcacgtttatgtctttgcca
gaggactacagagaagaattcatagcccagctccataacgcgctcagtggatatcaaaca
aacaatgttgatgaagcggtccaagccggggagatgagcaatatcaaatgtgtcggaatc
acgatagagacacgtccagattattgtttggacactcatctcagtgctatgctcaggtac
ggctgtacgagattggagatcggtgtgcagagtctttacgaagatgtcgcaagggatacg
aaccgaggacacactgtggcggctgtggcggagacgtttaaactggcgaaggatgctggt
ttcaaggtcgtcagccacatgatgccagatctacctaacgtggggatggaaagagatttg
ttccagttccaagaatactttgagaacccagccttccgaacggacggtctgaaaatctac
ccaacactagtcatcagaggtaccggtctctatgagctttggcggactggtcgctacaag
aactataccccaaatgctttgattgacattgtcgctcgcatccttgccctggtgccccca
tggactcgtatctatcgtgtgcagcgtgatattcctatgcctcttgtcacatccggcgtt
gagaacggtaaccttcgcgaactcgctcttggtcgaatgaaagatttcggcaccacttgc
agagacgtgcggactcgagaagttggaattaacgaagtcaagaataagatccgaccaagc
cagattgagctaattcggcgtgattacgtcgccaatgacggatgggagactttccttgcc
tatgaagacccgaaacaggatattctcattggccttctccgtctacgaaagtgcagtgca
aagtataccttccgcccagagcttaccggtcaacagactagtttggtccgtgagctgcat
gtatacggttcagctgttcccgttcacggtcgtgatcctcggaagttccaacatcgcgga
tttggaaccctgttgatggaagaggccgagaggatagcaagagaggagcatggaagtcga
aagattagcgtcatctctggggtcggtgtcagaagttattacgcaaagcttgggtattgg
ctcgatggaccatacatgagcaagatgctcgatccagtggagccggaagatgctgaagaa
taa

DBGET integrated database retrieval system