KEGG   Coccidioides posadasii: CPC735_026560Help
Entry
CPC735_026560     CDS       T01332                                 

Definition
catechol O-methyltransferase, putative
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cpw  Coccidioides posadasii
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cpw00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 210 aa AA seqDB search
MNVGQRKGKIVTSLIEEVKPQVMIELGSYVGYSAILFGDALRRVGGKKYYTLEKSPEYAA
VANMLLDLAGLRDFVKVLVGSSDVLLHKLCTTGEIITIELMFLDHFKPAYTTDLKLCEQL
GMVAAGTVLAADNMIMPGNPVYLDYVRSSVETKRSKAKTSPSGYEIFSQNIMSWYVDKDA
KPAFDAVGNPNLIYESRLVESFEPSGEPVC
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaggccaacgcaaggggaaaatcgttaccagcctcatcgaggaggttaaacca
caggtgatgatcgagcttgggtcttatgtcgggtactctgccattctgtttggggatgct
ctgcgtcgtgtgggcggcaagaagtactacaccttggagaagagtcctgaatatgctgcc
gtcgccaatatgctgcttgatcttgccggcttgcgagactttgttaaggtcttggtcggg
agtagcgacgttttgctgcataaattatgcaccaccggcgagattatcacaatcgaactc
atgttcctcgaccatttcaagcctgcctataccactgatttgaaactttgtgagcaactc
ggcatggttgcagctgggaccgtccttgccgctgataacatgatcatgcctggtaacccg
gtatatttggattacgtgcgaagcagcgttgaaaccaagaggagcaaggcgaaaacgtct
cctagtggatatgagatattctctcagaacatcatgtcttggtatgtcgacaaagatgcg
aaaccggcgttcgatgccgtcggtaatccgaatttgatttacgaaagccggttggtcgag
agctttgaaccatctggagagcccgtatgttag

DBGET integrated database retrieval system