KEGG   Coccidioides posadasii: CPC735_026600Help
Entry
CPC735_026600     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
cpw  Coccidioides posadasii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CPC735_026600
  Replication and repair
   03420 Nucleotide excision repair
    CPC735_026600
Transcription machinery [BR:cpw03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CPC735_026600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 424 aa AA seqDB search
MLEDDIYRTSTQYRLWSFTKESLNSIRENTNSLASVRVRDAIRRAQEARPATSTPGGSDE
PDSKTNTPAGPESEIECLTPEDELELVQYYCEKTLELGDEYKPPLPTTVRATAIQYLRRF
YVTNSPMTYHPKSIMPCALFLATKTDNYYMSLRSFAEKIPNTTAEDIIAPEFLLTQGLRF
AFDIRHPFRGLEGGVMELTAIAKGEGAPGPHHPEQTAAKLQEAIQAIPPAEGAAPSASIT
DRIASAHGKTRQILKTAAQMTDAYFLYTPSQIWLSALLLVDQPLLEFYLDTKLGPAPSGS
PPASAPESALAMLFALRAKLTGVLESCSTLLGTYLNTHDPNVPPDPARMKNLKRIGKKLY
HCQNPEKFSELSAGRTQRREGSGSTTPALLPTAGGGDVDETEGPAVKKRKLEKEAEEAGN
GGNK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaggacgacatctatcgaacgtccacccagtaccggctctggtcgttcaccaag
gaatctttaaattctattcgagaaaacaccaattcccttgcgagcgttcgtgttcgagat
gcgatccgtcgggcgcaagaagctcgccccgcgacttcgacgcctggaggcagcgatgaa
ccagattcaaagaccaatacacccgcagggcctgagagtgagattgagtgtttgacgccg
gaagacgaattggaattggtgcaatattattgtgagaaaacgctggagctcggggatgaa
tacaagcctccgctgccgacgacggtgagggccaccgctattcaatatctgcgccgtttc
tatgtcaccaactcgcctatgacctatcacccgaaatcaataatgccctgtgcccttttt
cttgccacgaaaacggacaattactacatgtccctgcgttcatttgcggaaaagatccct
aatacgactgcagaggatattatagctccagaattcctgcttactcagggcctacgattc
gcgtttgacatccgccacccctttcggggcctggaaggcggagtcatggaactcaccgcc
atagcaaaaggcgaaggtgcgcctggtccccatcacccagagcaaacggccgcaaagctc
caagaagccatccaggccattcctccggcagagggagcggcaccgtcagcctccataacg
gaccgtatcgcctccgcccatgggaagacaagacaaatcctcaaaaccgccgcccaaatg
acagatgcctacttcctttacacaccctcacagatctggctttctgccctcctcctcgtg
gaccagcccctcctggaattttacctcgatacaaaactcggccccgcgccgtctggttcc
ccgccagccagcgctccagaatccgctctagccatgcttttcgccctccgtgcaaagctc
acgggtgtcctggagtcttgctccacgctcctggggacgtatctaaacacccatgacccc
aatgtccctccagatccggcccgcatgaagaacctaaaacgcattggcaaaaaactttac
cactgccaaaaccccgagaagttctctgagctaagcgcgggtaggacccagaggagggag
ggttcggggagcaccacgccagccctgctccctaccgctggcggaggcgatgtggatgag
actgagggtcctgctgtcaaaaagaggaagttggagaaggaggcggaggaggctggtaat
ggtggtaataaatga

DBGET integrated database retrieval system