KEGG   Coccidioides posadasii: CPC735_029070Help
Entry
CPC735_029070     CDS       T01332                                 

Definition
histone deacetylase clr3, putative
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CPC735_029070
Protein phosphatases and associated proteins [BR:cpw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPC735_029070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 760 aa AA seqDB search
MDADEDIVMTGTGPTVPVGAGQPSSASPKKLGTELQLNGAFQAESLLASFQRKVVAPGNL
IKEVEDHQASSVPTVKSEENKEEPEQKEEEEISADEDESVSSDQSDEVPKLLPVSSLPSG
VCYDIRMRYHCEVKPTLDVHPEDPRRIYYIYKELCKAGLVDDPDASRPLVSQPLLRIPAR
DATHEEISLIHDSEHYDFVLSTKDMSEDELIALESTRDSIYFNTLTFTSAILACGGAIET
CKAVVSGKVKNAIAVIRPPGHHAEQCQAMGFCLFNNVSVAARVCQKTFKDKCRKIMIVDW
DVHHGNGVQNAFYDDPNVLYISLHVYKDGAFYPGGEQGNWDHCGEGNGLGKNVNIPWPTQ
GMGDGDYLYAFQEVIMPIGYEFNPDLVIISAGFDAAAGDELGGCFVTPPCYAHMTSMLMN
LANGKVAVCLEGGYNFRSISKSALAVTRTLMGEPPDRLIGVGASQAGVSTVRKVTMIQSK
YWQCMYPKGPPERFWGNRVHDIIRQYQAKQLYDEYKLTSLFIYRNSISKSFENQVLASRN
YDWQVPLLVIFHDPPELMGIPHPLTNKLEAHNCWMADGVKDYIEWAMNRNIAVIDVNIPK
HITRSNTADRYEDEDRSKEKMASELAVYLWENYIEPNEASHVFFLGVGDAFGGLADLLIE
KERVYPRVSGVISFVAENVVRAVSSHTNIWLSKWYKDNSLIYVSHHHGVFNIPEGSKRPS
KRYGRILRSPKKTLNEMLLAHMDDVTKWIEERIQEETEEE
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagacgaggacatcgtcatgacggggactggcccaacggtccctgtcggggct
ggtcagccgtcaagcgcctctccgaaaaagctaggtacggaactacaattgaacggagct
tttcaggccgagtcgctattagcatcgtttcaaagaaaagtcgtggcgcccgggaatcta
attaaagaagtggaagatcaccaagctagctccgtcccgaccgtgaagtcggaagagaat
aaggaagagcccgagcaaaaggaagaagaggagatctctgcagacgaggacgagtctgta
tcgtcggatcagagcgatgaggtcccgaaactacttcccgtttcgtcgttgccgtctggc
gtgtgctatgacattcggatgcgctatcattgtgaggtgaagccgactctagatgttcac
ccagaggacccaaggcgtatctactacatttacaaggagctttgcaaagctggacttgtc
gatgatccagatgcttcaaggccgcttgtatctcagccattgcttcgtattcctgcgaga
gatgccacgcacgaggagatatcgttgattcacgattctgagcactatgactttgttctc
agcacgaaagacatgtccgaagatgagttgattgcattggagagtactcgagactcgata
tatttcaatactctcacgtttacttcggcgattctagcctgcggcggtgccattgaaact
tgcaaggcagtggtctcaggaaaggtgaagaacgcgattgcagtgattcgtcctcctgga
catcacgcagagcagtgccaggcaatgggcttttgcctgtttaataacgtcagcgttgcg
gcaagagtttgccagaaaactttcaaggataagtgccggaaaataatgattgtggattgg
gatgtgcaccatggcaatggagtccaaaatgcgttttatgacgacccaaatgtgttgtat
atctctctccatgtctataaagatggtgctttctacccaggcggcgagcaggggaattgg
gaccactgtggtgaaggcaatgggctaggaaagaatgtcaatatcccatggccaacccaa
ggcatgggtgacggtgactatctctatgctttccaggaagttatcatgccaattggctac
gagtttaatccggatcttgttatcatctcggccgggttcgatgctgctgcaggtgatgag
ctcggaggctgcttcgtcactccgccgtgctatgctcacatgacttctatgctgatgaat
cttgcgaatggcaaagtagctgtttgcttggagggtggatacaacttccgctcgatttcg
aaatccgcgctcgcggtgactagaacgctgatgggagagccaccggacagactcattggt
gttggtgcgtcacaggcgggagtctcgacagttcgtaaggtaaccatgattcagtctaag
tactggcaatgcatgtatcctaaagggcctccggagagattctggggtaatcgagttcac
gatatcattcgacaataccaagcgaaacagctttacgatgagtacaagctaactagcctg
ttcatctatcgaaattctatttccaaatcttttgagaatcaagttcttgcaagtcggaat
tatgattggcaagtcccgctacttgtcatcttccatgaccctccagagctcatgggaatc
ccccatcctctgaccaataagttggaggcacacaactgctggatggctgatggcgtcaag
gactatattgaatgggcaatgaacaggaatatagccgttatcgacgtcaatatcccaaag
cacatcaccaggagcaataccgccgataggtacgaggatgaggaccggagcaaggagaag
atggcaagcgagcttgcagtttatctctgggaaaattacatcgagccaaacgaagctagc
cacgttttctttctgggagttggcgatgcgtttgggggtctcgcagacttgctcatcgaa
aaagagcgcgtgtacccccgcgtcagcggcgtcatctcctttgttgccgagaacgtagtc
cgggcagtgtcaagccacacaaacatctggctttctaagtggtataaagataactcttta
atatatgtttcgcaccatcacggcgtcttcaacattcccgaaggctccaagagaccttca
aagcgctacgggcgcattcttagatccccgaagaagaccctcaacgagatgctccttgcc
cacatggatgacgtgacgaagtggatagaagagaggatccaagaggagaccgaagaagag
tga

DBGET integrated database retrieval system