KEGG   Coccidioides posadasii: CPC735_029470Help
Entry
CPC735_029470     CDS       T01332                                 

Definition
glycogen [starch] synthase, putative
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cpw  Coccidioides posadasii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPC735_029470
Enzymes [BR:cpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CPC735_029470
Glycosyltransferases [BR:cpw01003]
 Polysaccharide
  Storage polysaccharide
   CPC735_029470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MAGNQGARQPPVLKRDVKSHILFEISTEVANRVGGIYSVLKSKAQVTTAEYGDRYTLIGP
WNRASAVVEVESLTPTNPHLAGAIDAMKERGIDIEYGRWLIEGAPRVILIDTGAGYQFLD
EWKGDLWNAAGIPSPPGDSETNEAIVFGYLVAWFLGEYICRDVDLAVVAHFHEWLAGVAL
PLTKKRRMDLTTIFTTHATLLGRYLCAGSVDFYNNLQNFDVDEEAGKRGIYHRYCIERAA
AHSADVFTTVSHITAYESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSHSKERIHDFV
RGHFYGHNDFDLENTLYFFIAGRYEYRNKGVDMFIESLARLNHRLRETGSTTTIVAFIIM
PAQTSSLTVEALKGQAVVKSLRDTLEMVEKGIGKRLFERCLSWREGDNMPDEKNLITAQD
RVLIRRRLFAMKRHSLPPIVTHNMLNDSEDPILNQLRRVQLFNYSTDRVKIVFHPEFLNS
SNPVLPLDYDDFVRGTNLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIEN
SSDYGIYIVDRRLKGVDDSVNQLTQYMFEFASKSRRQRINQRNRTERLSDLLDWKRMGLE
YVKARQLALRRAYPMSFDPEEDFRDIIGGTEQKISRPLSIPGSPRDRSGMMTPGDFASLQ
EGREGLSTDDYVSWKLPDEEEADEYPFPIALRTRTKEKVEPPHSPDRDVAPNGS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaatcaaggtgcacgtcagccgccggtgctaaaacgcgatgtcaagagccac
attctcttcgagatctcgactgaagttgcgaacagagtgggtggcatttactcggtcctc
aagtccaaagcccaagtaaccaccgctgaatatggtgaccgatatacgttgattgggccc
tggaatagagcttcggccgttgtcgaagttgagtcacttaccccaaccaatccgcacctc
gctggggcgatagatgcgatgaaagaaagaggcattgatatcgaatatggaagatggcta
attgaaggcgctccacgagttattttgattgacaccggtgccggttatcagttcctagat
gaatggaaaggcgatctctggaatgccgccggcattccatctcctccaggggatagcgaa
accaacgaagccattgttttcggatacttggtcgcgtggttcctaggcgagtatatatgc
agagatgtggatcttgcggtagtcgctcactttcacgagtggcttgctggcgtcgctcta
cccctgaccaagaaaaggcgcatggatctaacgacaatattcaccactcatgccaccctt
ctcggaaggtacctttgcgctggctctgttgacttctataataatctgcaaaactttgat
gtcgacgaggaggctggaaagcgtggaatataccaccgatactgcatcgaacgcgccgcg
gcccattcagcagatgtcttcactaccgtttcccacattactgcatatgaaagcgagcat
ttgctcaaacgaaagcctgatggcgtattgccaaacggtctaaacgtgaagaagttttca
gccgttcacgaattccagaatctccattcgcattctaaagagaggatccatgactttgta
cgaggtcatttctatggccataacgactttgacctcgaaaacacactctacttcttcatc
gctggccgctatgagtatagaaacaagggggtggatatgtttatcgaatcgctggcgcgt
cttaaccaccgtttaagggaaactggatcgactactaccatcgtcgcatttatcattatg
cccgctcaaacatcgtctcttactgttgaggctctaaaaggtcaggcggttgttaaatca
ctacgagatacactagaaatggtggagaagggaatcgggaagcgcctgtttgagcggtgt
ttaagctggcgtgaaggtgacaacatgccagacgagaagaatctcatcaccgctcaagat
agggtcctcatccgtcgccggctctttgctatgaagcgtcatagcttgcccccaattgtg
acccataacatgctaaatgactccgaggacccaattctaaaccagctccgtagggtgcag
ctgtttaactattcaacggatcgcgtgaaaatagtatttcaccctgagttcctgaactcc
tcgaatccagtgcttcctttggactatgacgactttgttcgcggcacgaatctcggagtg
ttcccttcgtactacgagccctgggggtatactccggccgagtgtacggtaatgggcgtc
ccaagcatcactaccaatctctcaggttttgggtgctatatggaggagcttattgaaaat
tcctctgactatggaatctatattgtggatcgccgtttaaaaggcgtggatgattcggtt
aatcagctcacccagtacatgtttgagtttgcgagtaagagcagaagacagcgtatcaac
cagagaaacagaactgagagactaagcgatctactggactggaagagaatgggattggag
tatgtgaaggcgaggcagctggctctgcgacgggcatacccgatgtctttcgacccagaa
gaagacttccgtgatattatcggcggaacagagcaaaagatatcgcgcccgctctccatc
cctggatctccgcgtgatcgctcgggaatgatgacaccgggtgattttgcatcactgcag
gaaggacgagaagggctgagcacagatgattatgtatcttggaagctgcctgatgaagag
gaagccgatgagtacccatttcccattgctcttagaaccagaacaaaagaaaaggtcgaa
cctccccattctcctgatcgggatgtggctccgaatggcagctag

DBGET integrated database retrieval system