KEGG   Coccidioides posadasii: CPC735_029520Help
Entry
CPC735_029520     CDS       T01332                                 

Definition
kinase, pfkB family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cpw  Coccidioides posadasii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CPC735_029520
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CPC735_029520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MPARIRVIGSLNADMVTVTPRFPGPGETLTARSFNTSAGGKGANQAVACGRLSRSQPRSS
TSDTQDEEIYVEMIGAVGRQDSYFSTLLKPTLEQSGVDIARIREVDGVHTGIAVIVVDSS
AGGENRILLSPGANYAGMQPTAELLDSVLSPPRPDVVVVQAEIPLTTVVEVLRRAGRQKE
QLRKEGVKGVDGEVEVVFNPAPAPEGGLPTDVYAAIDHLIMNETECDIMAPKELRDISEP
EERRGQIAKHFHSLGVRYVIVTLGSEGVWYSAADVGSKAQDDVKTWIRCINHIPAAKVEK
VVDTTGAGDTFVGGYSVQVARWREQRRLLGKANECLTDDERRERYHKGIEEAIRTAVRAS
AQCVQRQGAMDSIPWKGEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccggattcgagtcatcggctccttgaatgccgacatggtcacagtgaccccg
cgcttccccgggccaggagaaactctcacagcgagatccttcaacaccagcgcaggtggc
aagggcgcaaaccaggccgtggcctgtggccgcctttcccgctcacagcctagatcgtcg
accagtgatacccaggatgaggagatttatgttgaaatgatcggtgccgtgggccgccag
gattcgtatttctctactctcttgaaaccaactctagaacagtctggtgtggatattgcg
cggattagggaagtggatggtgtgcatacaggcatcgccgtgattgttgttgacagttcg
gctggtggcgagaataggattttgctctctccaggtgccaattacgcggggatgcagcct
acagcagagcttttggactcagtactgtcgcctcctcgaccagatgtggtggtggtgcag
gcagagatcccactgacgacggtggttgaagttctgaggcgggccgggcgtcaaaaggag
caactacgcaaagaaggtgtcaagggcgtggatggagaggtcgaggttgtgtttaacccc
gctccggctccagagggcggcctacctacagacgtatatgcggcaattgaccatttgatc
atgaacgaaacggaatgtgatattatggcgccgaaggagctgagggatatctctgagcca
gaagaacgcaggggccagatcgcaaaacatttccatagcttaggtgtacggtatgtcata
gttacactgggctcggagggagtatggtatagtgcagctgatgtgggcagcaaggcccaa
gacgacgtcaaaacgtggattcgctgcattaatcatattcctgccgcaaaagtggaaaag
gttgtggacaccacgggtgcgggagacaccttcgtgggcggctattcggtgcaagtggct
cgatggagagagcagagacggttgcttgggaaggccaacgaatgccttacagatgatgag
cggagagaacggtatcacaaaggaattgaagaggcaattcgaacggcggtccgggcttcg
gcccagtgtgttcagcggcaaggagccatggatagcattccatggaagggagagatctga

DBGET integrated database retrieval system